Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of BTG2 expression in transfected 293T cell line by BTG2 monoclonal antibody (M02), clone 1B8.Lane 1: BTG2 transfected lysate (17.4 KDa).Lane 2: Non-transfected lysate.)

Mouse BTG2 Monoclonal Antibody | anti-BTG2 antibody

BTG2 (BTG Family, Member 2, MGC126063, MGC126064, PC3, TIS21) (PE)

Gene Names
BTG2; PC3; APRO1; TIS21
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
BTG2; Monoclonal Antibody; BTG2 (BTG Family; Member 2; MGC126063; MGC126064; PC3; TIS21) (PE); BTG Family; TIS21; anti-BTG2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B8
Specificity
Recognizes BTG2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-BTG2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
BTG2 (NP_006754, 59aa-158aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLGRSSPSKNYVMAVSS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of BTG2 expression in transfected 293T cell line by BTG2 monoclonal antibody (M02), clone 1B8.Lane 1: BTG2 transfected lysate (17.4 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of BTG2 expression in transfected 293T cell line by BTG2 monoclonal antibody (M02), clone 1B8.Lane 1: BTG2 transfected lysate (17.4 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-BTG2 antibody
The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein is involved in the regulation of the G1/S transition of the cell cycle. [provided by RefSeq]
Product Categories/Family for anti-BTG2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
protein BTG2
NCBI Official Synonym Full Names
BTG anti-proliferation factor 2
NCBI Official Symbol
BTG2
NCBI Official Synonym Symbols
PC3; APRO1; TIS21
NCBI Protein Information
protein BTG2
UniProt Protein Name
Protein BTG2
Protein Family
UniProt Gene Name
BTG2
UniProt Synonym Gene Names
PC3

NCBI Description

The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein is involved in the regulation of the G1/S transition of the cell cycle. [provided by RefSeq, Jul 2008]

Uniprot Description

Anti-proliferative protein; the function is mediated by association with deadenylase subunits of the CCR4-NOT complex. Activates mRNA deadenylation in a CNOT6 and CNOT7-dependent manner. In vitro can inhibit deadenylase activity of CNOT7 and CNOT8. Involved in cell cycle regulation. Could be involved in the growth arrest and differentiation of the neuronal precursors (). Modulates transcription regulation mediated by ESR1. Involved in mitochondrial depolarization and neurite outgrowth.

Research Articles on BTG2

Similar Products

Product Notes

The BTG2 btg2 (Catalog #AAA6184182) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's BTG2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BTG2 btg2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BTG2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.