Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.7kD).)

Mouse anti-Human BTBD9 Monoclonal Antibody | anti-BTBD9 antibody

BTBD9 (KIAA1880, BTB/POZ Domain-containing Protein 9, FLJ32945, MGC120517, MGC120519, MGC120520)

Gene Names
BTBD9; dJ322I12.1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
BTBD9; Monoclonal Antibody; BTBD9 (KIAA1880; BTB/POZ Domain-containing Protein 9; FLJ32945; MGC120517; MGC120519; MGC120520); Anti -BTBD9 (KIAA1880; anti-BTBD9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3H3
Specificity
Recognizes human BTBD9.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
RESQPEAEIPLQDTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAHKYGFPELEDSTSEYLCTILN
Applicable Applications for anti-BTBD9 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa2-71 from human BTBD9 (NP_689946) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.7kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.7kD).)

Western Blot (WB)

(Western Blot analysis of BTBD9 expression in transfected 293T cell line by BTBD9 monoclonal antibody.|Lane 1: BTBD9 transfected lysate (65.7kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of BTBD9 expression in transfected 293T cell line by BTBD9 monoclonal antibody.|Lane 1: BTBD9 transfected lysate (65.7kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged BTBD9 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged BTBD9 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-BTBD9 antibody
This locus encodes a BTB/POZ domain-containing protein. This domain is known to be involved in protein-protein interactions. Polymorphisms at this locus have been reported to be associated with susceptibility to Restless Legs Syndrome and may also be associated with Tourette Syndrome.
Product Categories/Family for anti-BTBD9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69,188 Da
NCBI Official Full Name
BTB/POZ domain-containing protein 9 isoform a
NCBI Official Synonym Full Names
BTB (POZ) domain containing 9
NCBI Official Symbol
BTBD9
NCBI Official Synonym Symbols
dJ322I12.1
NCBI Protein Information
BTB/POZ domain-containing protein 9
UniProt Protein Name
BTB/POZ domain-containing protein 9
UniProt Gene Name
BTBD9
UniProt Synonym Gene Names
KIAA1880
UniProt Entry Name
BTBD9_HUMAN

NCBI Description

This locus encodes a BTB/POZ domain-containing protein. This domain is known to be involved in protein-protein interactions. Polymorphisms at this locus have been reported to be associated with susceptibility to Restless Legs Syndrome and may also be associated with Tourette Syndrome. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2011]

Uniprot Description

BTBD9: Genetic variations in BTBD9 may be associated with susceptibility to restless legs syndrome type 6 (RLS6); also called periodic limb movements in sleep. Restless legs syndrome (RLS) is a neurologic disorder characterized by an uncontrollable urge to move the legs during periods of rest. The majority of patients with RLS also have periodic limb movements in sleep, which are characterized by involuntary, highly stereotypical, regularly occurring limb movements that occur during sleep. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 6p21

Biological Process: circadian sleep/wake cycle, non-REM sleep; long-term memory; adult locomotory behavior; sensory perception of temperature stimulus; serotonin metabolic process

Disease: Restless Legs Syndrome, Susceptibility To, 6

Research Articles on BTBD9

Similar Products

Product Notes

The BTBD9 btbd9 (Catalog #AAA644375) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BTBD9 (KIAA1880, BTB/POZ Domain-containing Protein 9, FLJ32945, MGC120517, MGC120519, MGC120520) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BTBD9 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the BTBD9 btbd9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RESQPEAEIP LQDTTAEAFT MLLKYIYTGR ATLTDEKEEV LLDFLSLAHK YGFPELEDST SEYLCTILN. It is sometimes possible for the material contained within the vial of "BTBD9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.