Mouse anti-Human BRK Monoclonal Antibody | anti-BRK antibody

BRK (Protein-tyrosine Kinase 6, Breast Tumor Kinase, Tyrosine-protein Kinase BRK, PTK6, FLJ42088) (FITC)

Cat. Num. AAA6146158

• Gene Names: PTK6; BRK
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: BRK; Monoclonal Antibody; BRK (Protein-tyrosine Kinase 6; Breast Tumor Kinase; Tyrosine-protein Kinase BRK; PTK6; FLJ42088) (FITC); anti-BRK antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2F11
• Specificity: Recognizes human PTK6.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-BRK antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa342-452, from human PTK6 (NP_005966) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: YLSHDHNIPYKWTAPEALSRGHYSTKSDVWSFGILLHEMFSRGQVPYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLMLTCWCRDPEQRPCFKALRERLSSFTSYENPT
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to PTK6 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml])

Product Categories/Family for anti-BRK antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 5174647
• NCBI GeneID: 5753
• NCBI Accession #: NP_005966
• NCBI GenBank Nucleotide #: NM_005975
• UniProt Accession #: Q13882; Q58F01; B2RCR3; B4DW46
• Molecular Weight: 14,465 Da
• NCBI Official Full Name: protein-tyrosine kinase 6 isoform 1
• NCBI Official Synonym Full Names: protein tyrosine kinase 6
• NCBI Official Symbol: PTK6
• NCBI Official Synonym Symbols: BRK
• NCBI Protein Information: protein-tyrosine kinase 6; PTK6 protein tyrosine kinase 6; breast tumor kinase; protein-tyrosine kinase BRK; tyrosine-protein kinase BRK
• UniProt Protein Name: Protein-tyrosine kinase 6
• Protein Family: BrkA autotransporter
• UniProt Gene Name: PTK6
• UniProt Synonym Gene Names: BRK
• UniProt Entry Name: PTK6_HUMAN

Uniprot Description

Brk: a tyrosine kinase of the Src family. May function as an intracellular signal transducer in epithelial tissues. Very high level expression in colon and high levels in small intestine and prostate, and low levels in some fetal tissues. Selectively expressed in breast tumors and cell lines, and perhaps in colon and prostate cancers. Also found in melanocytes. Not expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Overexpression in mammary cells leads to EGF sensitization and results in a partially transformed phenotype. Enhances anchorage-independent growth and responsiveness to EGF. RNAi reduces proliferation in breast cancer cells. Kinase-inactive mutant indicates tumor function may be independent of catalytic function.

Protein type: Protein kinase, TK; Protein kinase, tyrosine (non-receptor); Kinase, protein; EC 2.7.10.2; TK group; Src family

Chromosomal Location of Human Ortholog: 20q13.3

Cellular Component: nucleoplasm; ruffle; extrinsic to internal side of plasma membrane; cytoplasm; nucleus

Molecular Function: identical protein binding; protein binding; non-membrane spanning protein tyrosine kinase activity; ATP binding; receptor binding

Biological Process: cell migration; protein amino acid autophosphorylation; innate immune response; tyrosine phosphorylation of Stat3 protein; actin cytoskeleton organization and biogenesis; tyrosine phosphorylation of Stat5 protein; protein amino acid phosphorylation; transmembrane receptor protein tyrosine kinase signaling pathway; regulation of cell proliferation; negative regulation of growth