Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human BPNT1 Monoclonal Antibody | anti-BPNT1 antibody

BPNT1 (3'(2'),5'-bisphosphate nucleotidase 1, Bisphosphate 3'-nucleotidase 1, PAP-inositol 1,4-phosphatase)

Gene Names
BPNT1; PIP
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
BPNT1; Monoclonal Antibody; BPNT1 (3'(2'); 5'-bisphosphate nucleotidase 1; Bisphosphate 3'-nucleotidase 1; PAP-inositol 1; 4-phosphatase); Anti -BPNT1 (3'(2'); anti-BPNT1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2E1
Specificity
Recognizes human BPNT1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPC
Applicable Applications for anti-BPNT1 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunofluorescence: 10ug/ml
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Partial recombinant corresponding to aa1-100 from BPNT1 (NP_006076) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of BPNT1 expression in transfected 293T cell line by BPNT1 monoclonal antibody.|Lane 1: BPNT1 transfected lysate (28.1kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of BPNT1 expression in transfected 293T cell line by BPNT1 monoclonal antibody.|Lane 1: BPNT1 transfected lysate (28.1kD).|Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to BPNT1 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to BPNT1 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to BPNT1 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to BPNT1 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged BPNT1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged BPNT1 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(BPNT1 monoclonal antibody Western Blot analysis of BPNT1 expression in HeLa.)

Western Blot (WB) (BPNT1 monoclonal antibody Western Blot analysis of BPNT1 expression in HeLa.)
Related Product Information for anti-BPNT1 antibody
BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.
Product Categories/Family for anti-BPNT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
33,392 Da
NCBI Official Full Name
BPNT1 protein
NCBI Official Synonym Full Names
3'(2'), 5'-bisphosphate nucleotidase 1
NCBI Official Symbol
BPNT1
NCBI Official Synonym Symbols
PIP
NCBI Protein Information
3'(2'),5'-bisphosphate nucleotidase 1; 3'(2'),5'-bisphosphate nucleotidase 1; BPntase; PAP-inositol 1,4-phosphatase; PAP-inositol-1,4-phosphatase; bisphosphate 3'-nucleotidase 1
UniProt Protein Name
3'(2'),5'-bisphosphate nucleotidase 1
UniProt Gene Name
BPNT1
UniProt Synonym Gene Names
PIP
UniProt Entry Name
BPNT1_HUMAN

NCBI Description

BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity. [provided by RefSeq, Jul 2008]

Uniprot Description

BPNT1: Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Has 1000-fold lower activity towards inositol 1,4-bisphosphate (Ins(1,4)P2) and inositol 1,3,4- trisphosphate (Ins(1,3,4)P3), but does not hydrolyze Ins(1)P, Ins(3,4)P2, Ins(1,3,4,5)P4 or InsP6. Belongs to the inositol monophosphatase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.3.7; Energy Metabolism - sulfur; Motility/polarity/chemotaxis; Phosphatase (non-protein)

Chromosomal Location of Human Ortholog: 1q41

Cellular Component: cytosol

Molecular Function: inositol-1,4-bisphosphate 1-phosphatase activity; magnesium ion binding; 3'(2'),5'-bisphosphate nucleotidase activity

Biological Process: nervous system development; dephosphorylation; phosphoinositide phosphorylation; xenobiotic metabolic process; nucleobase, nucleoside, nucleotide and nucleic acid metabolic process; 3'-phosphoadenosine 5'-phosphosulfate metabolic process

Research Articles on BPNT1

Similar Products

Product Notes

The BPNT1 bpnt1 (Catalog #AAA6005221) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BPNT1 (3'(2'),5'-bisphosphate nucleotidase 1, Bisphosphate 3'-nucleotidase 1, PAP-inositol 1,4-phosphatase) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BPNT1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the BPNT1 bpnt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASSNTVLMR LVASAYSIAQ KAGMIVRRVI AEGDLGIVEK TCATDLQTKA DRLAQMSICS SLARKFPKLT IIGEEDLPSE EVDQELIEDS QWEEILKQPC. It is sometimes possible for the material contained within the vial of "BPNT1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.