Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of BOLL expression in transfected 293T cell line by BOLL monoclonal antibody (M01), clone 1F3.Lane 1: BOLL transfected lysate (31.301 KDa).Lane 2: Non-transfected lysate.)

Mouse BOLL Monoclonal Antibody | anti-BOLL antibody

BOLL (Bol, Boule-like (Drosophila)) (FITC)

Gene Names
BOLL; BOULE
Applications
Western Blot
Purity
Purified
Synonyms
BOLL; Monoclonal Antibody; BOLL (Bol; Boule-like (Drosophila)) (FITC); Bol; Boule-like (Drosophila); anti-BOLL antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F3
Specificity
Recognizes BOLL.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-BOLL antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
BOLL (NP_149019, 185aa-283aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of BOLL expression in transfected 293T cell line by BOLL monoclonal antibody (M01), clone 1F3.Lane 1: BOLL transfected lysate (31.301 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of BOLL expression in transfected 293T cell line by BOLL monoclonal antibody (M01), clone 1F3.Lane 1: BOLL transfected lysate (31.301 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged BOLL is approximately 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged BOLL is approximately 0.3ng/ml as a capture antibody.)
Related Product Information for anti-BOLL antibody
This gene belongs to the DAZ gene family required for germ cell development. It encodes an RNA-binding protein which is more similar to Drosophila Boule than to human proteins encoded by genes DAZ (deleted in azoospermia) or DAZL (deleted in azoospermia-like). Loss of this gene function results in the absence of sperm in semen (azoospermia). Histological studies demonstrated that the primary defect is at the meiotic G2/M transition. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-BOLL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,256 Da
NCBI Official Full Name
protein boule-like isoform 2
NCBI Official Synonym Full Names
boule-like RNA-binding protein
NCBI Official Symbol
BOLL
NCBI Official Synonym Symbols
BOULE
NCBI Protein Information
protein boule-like; bol, boule-like
UniProt Protein Name
Protein boule-like
Protein Family
UniProt Gene Name
BOLL
UniProt Synonym Gene Names
BOULE
UniProt Entry Name
BOLL_HUMAN

Uniprot Description

BOLL: Probable RNA-binding protein, which may be required during spermatogenesis. May act by binding to the 3'-UTR of mRNAs and regulating their translation. Belongs to the RRM DAZ family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Translation

Chromosomal Location of Human Ortholog: 2q33

Cellular Component: cytoplasm

Molecular Function: protein binding; translation activator activity; RNA binding; nucleotide binding

Biological Process: positive regulation of translational initiation; meiosis; multicellular organismal development; spermatogenesis; cell differentiation

Similar Products

Product Notes

The BOLL boll (Catalog #AAA6175158) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's BOLL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BOLL boll for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BOLL, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.