Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (BMPR1B monoclonal antibody (M07), clone 2E2. Western Blot analysis of BMPR1B expression in HeLa (Cat # L013V1).)

Mouse BMPR1B Monoclonal Antibody | anti-BMPR1B antibody

BMPR1B (Bone Morphogenetic Protein Receptor, Type IB, ALK-6, ALK6, CDw293) (HRP)

Gene Names
BMPR1B; ALK6; AMDD; BDA2; ALK-6; BDA1D; CDw293
Applications
Western Blot
Purity
Purified
Synonyms
BMPR1B; Monoclonal Antibody; BMPR1B (Bone Morphogenetic Protein Receptor; Type IB; ALK-6; ALK6; CDw293) (HRP); Bone Morphogenetic Protein Receptor; CDw293; anti-BMPR1B antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
200
Specificity
Recognizes BMPR1B.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
502
Applicable Applications for anti-BMPR1B antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
BMPR1B (AAH47773.1, 24aa-127aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMIEEDDSGLPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCTERNECNKDLHPTLPPLKNRDFVDGPIHHRA
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(BMPR1B monoclonal antibody (M07), clone 2E2. Western Blot analysis of BMPR1B expression in HeLa (Cat # L013V1).)

Western Blot (WB) (BMPR1B monoclonal antibody (M07), clone 2E2. Western Blot analysis of BMPR1B expression in HeLa (Cat # L013V1).)

Testing Data

(Detection limit for recombinant GST tagged BMPR1B is approximately 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged BMPR1B is approximately 3ng/ml as a capture antibody.)

Western Blot (WB)

(BMPR1B monoclonal antibody (M07), clone 2E2. Western Blot analysis of BMPR1B expression in NIH/3T3.)

Western Blot (WB) (BMPR1B monoclonal antibody (M07), clone 2E2. Western Blot analysis of BMPR1B expression in NIH/3T3.)
Product Categories/Family for anti-BMPR1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
658
NCBI Official Full Name
BMPR1B protein
NCBI Official Synonym Full Names
bone morphogenetic protein receptor type 1B
NCBI Official Symbol
BMPR1B
NCBI Official Synonym Symbols
ALK6; AMDD; BDA2; ALK-6; BDA1D; CDw293
NCBI Protein Information
bone morphogenetic protein receptor type-1B

NCBI Description

This gene encodes a member of the bone morphogenetic protein (BMP) receptor family of transmembrane serine/threonine kinases. The ligands of this receptor are BMPs, which are members of the TGF-beta superfamily. BMPs are involved in endochondral bone formation and embryogenesis. These proteins transduce their signals through the formation of heteromeric complexes of 2 different types of serine (threonine) kinase receptors: type I receptors of about 50-55 kD and type II receptors of about 70-80 kD. Type II receptors bind ligands in the absence of type I receptors, but they require their respective type I receptors for signaling, whereas type I receptors require their respective type II receptors for ligand binding. Mutations in this gene have been associated with primary pulmonary hypertension. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Feb 2012]

Research Articles on BMPR1B

Similar Products

Product Notes

The BMPR1B (Catalog #AAA6182028) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's BMPR1B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BMPR1B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BMPR1B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.