Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for MBS645909 is ~0.3ng/ml using MBS645909 as a capture antibody.)

Mouse anti-Human BMP9 Monoclonal Antibody

BMP9 (Growth/Differentiation Factor 2, GDF-2, Bone Morphogenetic Protein 9, BMP-9, GDF2)

Reactivity
Human
Applications
ELISA
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
BMP9; Monoclonal Antibody; BMP9 (Growth/Differentiation Factor 2; GDF-2; Bone Morphogenetic Protein 9; BMP-9; GDF2); Anti -BMP9 (Growth/Differentiation Factor 2; anti-BMP9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4D2
Specificity
Recognizes human GDF2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYE
Applicable Applications for anti-BMP9 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa320-419 from human GDF2 (NP_057288) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for MBS645909 is ~0.3ng/ml using MBS645909 as a capture antibody.)

Testing Data (Detection limit for MBS645909 is ~0.3ng/ml using MBS645909 as a capture antibody.)
Related Product Information for anti-BMP9 antibody
GDF2 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in rodents suggest that this protein plays a role in the adult liver and in differentiation of cholinergic central nervous system neurons.
Product Categories/Family for anti-BMP9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Official Full Name
bone morphogenetic protein 9

Uniprot Description

GDF2: Could be involved in bone formation. Belongs to the TGF-beta family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 10q11.22

Cellular Component: extracellular space

Molecular Function: protein binding; growth factor activity; cytokine activity; transforming growth factor beta receptor binding

Biological Process: cellular iron ion homeostasis; positive regulation of transcription, DNA-dependent; activin receptor signaling pathway; positive regulation of interleukin-8 production; regulation of apoptosis; BMP signaling pathway; positive regulation of endothelial cell differentiation; angiogenesis; vasculogenesis; positive regulation of BMP signaling pathway; ossification; negative regulation of blood vessel endothelial cell migration; patterning of blood vessels; osteoblast differentiation; positive regulation of osteoblast differentiation; positive regulation of angiogenesis; negative regulation of angiogenesis; negative regulation of DNA replication; cartilage development; regulation of MAPKKK cascade; negative regulation of endothelial cell proliferation; blood vessel morphogenesis; positive regulation of transcription from RNA polymerase II promoter; positive regulation of endothelial cell proliferation; negative regulation of cell growth; cell development; growth

Disease: Telangiectasia, Hereditary Hemorrhagic, Type 5

Similar Products

Product Notes

The BMP9 (Catalog #AAA645909) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BMP9 (Growth/Differentiation Factor 2, GDF-2, Bone Morphogenetic Protein 9, BMP-9, GDF2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BMP9 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the BMP9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SAGAGSHCQK TSLRVNFEDI GWDSWIIAPK EYEAYECKGG CFFPLADDVT PTKHAIVQTL VHLKFPTKVG KACCVPTKLS PISVLYKDDM GVPTLKYHYE. It is sometimes possible for the material contained within the vial of "BMP9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.