Mouse BMP5 Monoclonal Antibody | anti-BMP5 antibody

BMP5 (Bone Morphogenetic Protein 5, MGC34244) (HRP)

Cat. Num. AAA6180553

• Applications: ELISA
• Purity: Purified
• Synonyms: BMP5; Monoclonal Antibody; BMP5 (Bone Morphogenetic Protein 5; MGC34244) (HRP); Bone Morphogenetic Protein 5; MGC34244; anti-BMP5 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1C1
• Specificity: Recognizes BMP5.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-BMP5 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: BMP5 (NP_066551.1, 341aa-440aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVIL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged BMP5 is 0.3 ng/ml as a capture antibody.)

Product Categories/Family for anti-BMP5 antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 10835091
• NCBI GeneID: 653
• NCBI Accession #: NP_066551.1
• NCBI GenBank Nucleotide #: NM_021073.2
• UniProt Accession #: P22003; Q9H547; Q9NTM5; B4E0Y4
• Molecular Weight: 47,670 Da
• NCBI Official Full Name: bone morphogenetic protein 5 preproprotein
• NCBI Official Synonym Full Names: bone morphogenetic protein 5
• NCBI Official Symbol: BMP5
• NCBI Protein Information: bone morphogenetic protein 5; BMP-5; bone morphogenenic protein-5
• UniProt Protein Name: Bone morphogenetic protein 5
• Protein Family: Bone morphogenetic protein
• UniProt Gene Name: BMP5
• UniProt Synonym Gene Names: BMP-5
• UniProt Entry Name: BMP5_HUMAN

NCBI Description

This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. This protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors. [provided by RefSeq, Jul 2008]

Uniprot Description

BMP5: Induces cartilage and bone formation. Belongs to the TGF-beta family.

Protein type: Secreted; Motility/polarity/chemotaxis; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 6p12.1

Cellular Component: extracellular space

Molecular Function: growth factor activity; cytokine activity; transforming growth factor beta receptor binding

Biological Process: ossification; negative regulation of insulin-like growth factor receptor signaling pathway; pattern specification process; BMP signaling pathway; regulation of apoptosis; negative regulation of cell proliferation; cartilage development; regulation of MAPKKK cascade; negative regulation of aldosterone biosynthetic process; male genitalia development; positive regulation of transcription from RNA polymerase II promoter; skeletal development; positive regulation of epithelial cell proliferation; growth