Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of 127251 (3ug/ml) on formalin-fixed paraffin-embedded human pancreas.)

Mouse anti-Human BMP11 Monoclonal Antibody | anti-BMP11 antibody

BMP11 (Growth/Differentiation Factor 11, GDF-11, Bone Morphogenetic Protein 11, BMP-11, GDF11) (Biotin)

Gene Names
GDF11; BMP11; BMP-11
Reactivity
Human
Applications
ELISA, Immunohistochemistry
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BMP11; Monoclonal Antibody; BMP11 (Growth/Differentiation Factor 11; GDF-11; Bone Morphogenetic Protein 11; BMP-11; GDF11) (Biotin); anti-BMP11 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3G6
Specificity
Recognizes human GDF11.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-BMP11 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa310-407 from GDF11 (NP_005802) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of 127251 (3ug/ml) on formalin-fixed paraffin-embedded human pancreas.)

Testing Data (Immunoperoxidase of 127251 (3ug/ml) on formalin-fixed paraffin-embedded human pancreas.)
Product Categories/Family for anti-BMP11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14.8kDa (132aa)
NCBI Official Full Name
growth/differentiation factor 11 preproprotein
NCBI Official Synonym Full Names
growth differentiation factor 11
NCBI Official Symbol
GDF11
NCBI Official Synonym Symbols
BMP11; BMP-11
NCBI Protein Information
growth/differentiation factor 11
UniProt Protein Name
Growth/differentiation factor 11
UniProt Gene Name
GDF11
UniProt Synonym Gene Names
BMP11; GDF-11; BMP-11
UniProt Entry Name
GDF11_HUMAN

NCBI Description

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein plays a role in the development of the nervous and other organ systems, and may regulate aging. [provided by RefSeq, Aug 2016]

Uniprot Description

GDF11: Secreted signal that acts globally to specify positional identity along the anterior/posterior axis during development. Play critical roles in patterning both mesodermal and neural tissues and in establishing the skeletal pattern. Belongs to the TGF-beta family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 12q13.2

Cellular Component: extracellular space

Molecular Function: growth factor activity; cytokine activity; transforming growth factor beta receptor binding

Biological Process: nervous system development; cell maturation; palate development; regulation of apoptosis; negative regulation of cell proliferation; negative regulation of cell differentiation; camera-type eye morphogenesis; spinal cord anterior/posterior patterning; ureteric bud development; regulation of MAPKKK cascade; pancreas development; mesoderm development; metanephros development; skeletal development; cell development; growth

Research Articles on BMP11

Similar Products

Product Notes

The BMP11 gdf11 (Catalog #AAA6142053) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BMP11 (Growth/Differentiation Factor 11, GDF-11, Bone Morphogenetic Protein 11, BMP-11, GDF11) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BMP11 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin. IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BMP11 gdf11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BMP11, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.