Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (85.47kD).)

Mouse anti-Human Biotinidase Monoclonal Antibody | anti-BTD antibody

Biotinidase (BTD, Biotinase) (FITC)

Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Biotinidase; Monoclonal Antibody; Biotinidase (BTD; Biotinase) (FITC); anti-BTD antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B10-2B3
Specificity
Recognizes human BTD.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-BTD antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-543 from human BTD (AAH12099) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAHAHIQGGRRAKSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAEYYVAAVYEHPSILSLNPLALISRQEALELMNQNLDIYEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSIYPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCHSSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMYDNFTLVPVWGKEGYLHVCSNGLCCYLLYERPTLSKELYALGVFDGLHTVHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSYIFPLFLTSGMTLEVPDQLGWENDHYFLRKSRLSSGLVTAALYGRLYERD
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (85.47kD).)

Western Blot (WB) (Western Blot detection against Immunogen (85.47kD).)

Western Blot (WB)

(Western Blot analysis of BTD expression in transfected 293T cell line by BTD monoclonal antibody. Lane 1: BTD transfected lysate (61.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of BTD expression in transfected 293T cell line by BTD monoclonal antibody. Lane 1: BTD transfected lysate (61.1kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of BTD transfected lysate using BTD monoclonal antibody and Protein A Magnetic Bead and immunoblotted with BTD rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of BTD transfected lysate using BTD monoclonal antibody and Protein A Magnetic Bead and immunoblotted with BTD rabbit polyclonal antibody.)
Related Product Information for anti-BTD antibody
Biotinidase (BTD) functions to recycle biotin in the body by cleaving biocytin (biotin-epsilon-lysine), a normal product of carboxylase degradation, resulting in regeneration of free biotin. Biotinidase has also been shown to have biotinyl-transferase activity. Defects in the biotinidase gene cause multiple carboxylase deficiency.
Product Categories/Family for anti-BTD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
686
Molecular Weight
58,913 Da
NCBI Official Full Name
Homo sapiens biotinidase, mRNA
NCBI Official Synonym Full Names
biotinidase
NCBI Official Symbol
BTD
NCBI Protein Information
biotinidase
Protein Family

NCBI Description

The protein encoded by this gene functions to recycle protein-bound biotin by cleaving biocytin (biotin-epsilon-lysine), a normal product of carboxylase degradation, resulting in regeneration of free biotin. The encoded protein has also been shown to have biotinyl transferase activity. Mutations in this gene are associated with biotinidase deficiency. Multiple transcript variants encoding different isoforms have been described. [provided by RefSeq, Aug 2013]

Research Articles on BTD

Similar Products

Product Notes

The BTD (Catalog #AAA6146166) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Biotinidase (BTD, Biotinase) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Biotinidase can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BTD for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Biotinidase, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.