Mouse BIN1 Monoclonal Antibody | anti-BIN1 antibody

BIN1 (bridging integrator 1, AMPH2, AMPHL, DKFZp547F068, MGC10367, SH3P9) (FITC)

Cat. Num. AAA6177182

• Gene Names: BIN1; AMPH2; AMPHL; SH3P9
• Applications: Western Blot
• Purity: Purified
• Synonyms: BIN1; Monoclonal Antibody; BIN1 (bridging integrator 1; AMPH2; AMPHL; DKFZp547F068; MGC10367; SH3P9) (FITC); bridging integrator 1; SH3P9; anti-BIN1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2C7
• Specificity: Recognizes BIN1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-BIN1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: BIN1 (NP_004296, 355aa-454aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged BIN1 is approximately 0.3ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of BIN1 expression in transfected 293T cell line by BIN1 monoclonal antibody (M03), clone 2C7.Lane 1: BIN1 transfected lysate (53 KDa).Lane 2: Non-transfected lysate.)

Related Product Information for anti-BIN1 antibody

MThis gene encodes several isoforms of a nucleocytoplasmic adaptor protein, one of which was initially identified as a MYC-interacting protein with features of a tumor suppressor. Isoforms that are expressed in the central nervous system may be involved in synaptic vesicle endocytosis and may interact with dynanim, synaptojanin, endophilin, and clathrin. Isoforms that are expressed in muscle and ubiquitously expressed isoforms localize to the cytoplasm and nucleus and activate a caspase-independent apoptotic process. Studies in mouse suggest that this gene plays an important role in cardiac muscle development. Alternate splicing of the gene results in ten transcript variants encoding different isoforms. Aberrant splice variants expressed in tumor cell lines have also been described. [provided by RefSeq]

Product Categories/Family for anti-BIN1 antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4757748
• NCBI GeneID: 274
• NCBI Accession #: NP_004296
• NCBI GenBank Nucleotide #: NM_004305
• UniProt Accession #: O00499; O00297; O00545; O43867; O60552; O60553; O60554; O60555; O75514; O75515; O75516; O75517
• Molecular Weight: 54,948 Da
• NCBI Official Full Name: myc box-dependent-interacting protein 1 isoform 8
• NCBI Official Synonym Full Names: bridging integrator 1
• NCBI Official Symbol: BIN1
• NCBI Official Synonym Symbols: AMPH2; AMPHL; SH3P9
• NCBI Protein Information: myc box-dependent-interacting protein 1; amphiphysin II; amphiphysin-like protein; box dependant MYC interacting protein 1; box-dependent myc-interacting protein 1
• UniProt Protein Name: Myc box-dependent-interacting protein 1
• Protein Family: Myc box-dependent-interacting protein
• UniProt Gene Name: BIN1
• UniProt Synonym Gene Names: AMPHL
• UniProt Entry Name: BIN1_HUMAN

Uniprot Description

BIN1: May be involved in regulation of synaptic vesicle endocytosis. May act as a tumor suppressor and inhibits malignant cell transformation. Defects in BIN1 are the cause of centronuclear myopathy type 2 (CNM2). A congenital muscle disorder characterized by progressive muscular weakness and wasting involving mainly limb girdle, trunk, and neck muscles. It may also affect distal muscles. Weakness may be present during childhood or adolescence or may not become evident until the third decade of life. Ptosis is a frequent clinical feature. The most prominent histopathologic features include high frequency of centrally located nuclei in muscle fibers not secondary to regeneration, radial arrangement of sarcoplasmic strands around the central nuclei, and predominance and hypotrophy of type 1 fibers. 11 isoforms of the human protein are produced by alternative splicing.

Protein type: Tumor suppressor; Cytoskeletal; Adaptor/scaffold; Vesicle

Chromosomal Location of Human Ortholog: 2q14

Cellular Component: I band; synaptic vesicle; membrane; axon; T-tubule; cytoplasm; nerve terminal; Z disc; nucleus; actin cytoskeleton

Molecular Function: identical protein binding; protein binding; GTPase binding; protein heterodimerization activity; protein complex binding; tau protein binding

Biological Process: cell proliferation; muscle cell differentiation; viral reproduction; regulation of neuron differentiation; positive regulation of apoptosis; positive regulation of endocytosis; endocytosis; positive regulation of GTPase activity; positive regulation of astrocyte differentiation

Disease: Myopathy, Centronuclear, 2