Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human BFAR Monoclonal Antibody | anti-BFAR antibody

BFAR (Bifunctional Apoptosis Regulator, RING Finger Protein 47, BAR, RNF47)

Gene Names
BFAR; BAR; RNF47
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
BFAR; Monoclonal Antibody; BFAR (Bifunctional Apoptosis Regulator; RING Finger Protein 47; BAR; RNF47); Anti -BFAR (Bifunctional Apoptosis Regulator; anti-BFAR antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C6
Specificity
Recognizes human BFAR.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
LRFEDIQQNNDIVQSLAAFQKYGNDQIPLAPNTGRANQQMGGGFFSGVLTALTGVAVVLLVYHWSSRESEHDLLVHKAVAKWTAEEVVLWLEQLGPWASL
Applicable Applications for anti-BFAR antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Partial recombinant corresponding to aa101-200 from human BFAR (AAH03054) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of BFAR expression in transfected 293T cell line by BFAR monoclonal antibody.|Lane 1: BFAR transfected lysate (52.7kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of BFAR expression in transfected 293T cell line by BFAR monoclonal antibody.|Lane 1: BFAR transfected lysate (52.7kD).|Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to BFAR on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to BFAR on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml].)

Western Blot (WB)

(Western blot analysis of BFAR over-expressed 293 cell line, cotransfected with BFAR Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with BFAR monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of BFAR over-expressed 293 cell line, cotransfected with BFAR Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with BFAR monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-BFAR antibody
BFAR is a apoptosis regulator. Has anti-apoptotic activity, both for apoptosis triggered via death-receptors and via mitochondrial factors.
Product Categories/Family for anti-BFAR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,738 Da
NCBI Official Full Name
bifunctional apoptosis regulator
NCBI Official Synonym Full Names
bifunctional apoptosis regulator
NCBI Official Symbol
BFAR
NCBI Official Synonym Symbols
BAR; RNF47
NCBI Protein Information
bifunctional apoptosis regulator; RING finger protein 47; bifunctional apoptosis inhibitor
UniProt Protein Name
Bifunctional apoptosis regulator
UniProt Gene Name
BFAR
UniProt Synonym Gene Names
BAR; RNF47
UniProt Entry Name
BFAR_HUMAN

Uniprot Description

Function: Apoptosis regulator. Has anti-apoptotic activity, both for apoptosis triggered via death-receptors and via mitochondrial factors. Ref.5

Subunit structure: Interacts with CASP8, BCL2 and BCL2L1 through SAM domain and also with HIP1, IFT57, ESRRBL1 and BCAP31. Ref.1 Ref.5

Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein Ref.1 Ref.5.

Tissue specificity: Expressed highly in brain, moderately in small intestine, weakly in testes and only faintly in liver and skeletal muscle. Not expressed in heart, kidney, lung and spleen. Ref.1 Ref.5

Sequence similarities: Contains 1 RING-type zinc finger.Contains 1 SAM (sterile alpha motif) domain.

Research Articles on BFAR

Similar Products

Product Notes

The BFAR bfar (Catalog #AAA645887) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BFAR (Bifunctional Apoptosis Regulator, RING Finger Protein 47, BAR, RNF47) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BFAR can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the BFAR bfar for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LRFEDIQQNN DIVQSLAAFQ KYGNDQIPLA PNTGRANQQM GGGFFSGVLT ALTGVAVVLL VYHWSSRESE HDLLVHKAVA KWTAEEVVLW LEQLGPWASL. It is sometimes possible for the material contained within the vial of "BFAR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.