Western Blot (WB)
(Western Blot detection against Immunogen (30.25kD).)
Mouse anti-Human BD-4 Monoclonal Antibody | anti-BD-4 antibody
BD-4 (Beta-defensin 104, Beta-defensin 4, DEFB104A, DEFB-4, hBD-4, Defensin, beta 104, DEFB104, DEFB4, DEFB104B) (Biotin)
Gene Names
DEFB4A; BD-2; SAP1; DEFB2; DEFB4; HBD-2; DEFB-2; DEFB102
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BD-4; Monoclonal Antibody; BD-4 (Beta-defensin 104; Beta-defensin 4; DEFB104A; DEFB-4; hBD-4; Defensin; beta 104; DEFB104; DEFB4; DEFB104B) (Biotin); anti-BD-4 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4C4
Specificity
Recognizes human DEFB4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-BD-4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa24-64 from human DEFB4 (NP_004933) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (30.25kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (30.25kD).)
Western Blot (WB)
(Western Blot analysis of DEFB4 expression in transfected 293T cell line by DEFB4 monoclonal antibody. Lane 1: DEFB4 transfected lysate (7.038kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of DEFB4 expression in transfected 293T cell line by DEFB4 monoclonal antibody. Lane 1: DEFB4 transfected lysate (7.038kD). Lane 2: Non-transfected lysate.)
Testing Data
(Detection limit for recombinant GST tagged DEFB4 is ~3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged DEFB4 is ~3ng/ml as a capture antibody.)
Product Categories/Family for anti-BD-4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
7,038 Da
NCBI Official Full Name
beta-defensin 4A
NCBI Official Synonym Full Names
defensin, beta 4A
NCBI Official Symbol
DEFB4A
NCBI Official Synonym Symbols
BD-2; SAP1; DEFB2; DEFB4; HBD-2; DEFB-2; DEFB102
NCBI Protein Information
beta-defensin 4A
NCBI Description
Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 4, an antibiotic peptide which is locally regulated by inflammation. [provided by RefSeq, Jul 2008]
Research Articles on BD-4
Similar Products
Product Notes
The BD-4 (Catalog #AAA6140816) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BD-4 (Beta-defensin 104, Beta-defensin 4, DEFB104A, DEFB-4, hBD-4, Defensin, beta 104, DEFB104, DEFB4, DEFB104B) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BD-4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BD-4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BD-4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
