Mouse anti-Human BCAR3 Monoclonal Antibody | anti-BCAR3 antibody

BCAR3 (Breast Cancer Anti-estrogen Resistance Protein 3, Novel SH2-containing Protein 2, SH2 Domain-containing Protein 3B, NSP2, SH2D3B, UNQ271/PRO308) (MaxLight 750)

Cat. Num. AAA6231757

• Gene Names: BCAR3; NSP2; SH2D3B
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: BCAR3; Monoclonal Antibody; BCAR3 (Breast Cancer Anti-estrogen Resistance Protein 3; Novel SH2-containing Protein 2; SH2 Domain-containing Protein 3B; NSP2; SH2D3B; UNQ271/PRO308) (MaxLight 750); anti-BCAR3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3G4
• Specificity: Recognizes human BCAR3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.

• Applicable Applications for anti-BCAR3 antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa266-373 from BCAR3 (AAH39895)with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: YGTSPGQAREGSLTKGRPDVAKRLSLTMGGVQAREQNLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPIGCKLPPQSSGVDTSPCPNSPVFRTGSEPA
• Conjugate: MaxLight750
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-BCAR3 antibody

In breast cancer, the antiestrogen tamoxifen has been prescribed for both primary treatment and the treatment of advanced metastatic disease. Although the drug induces remission in most patients with estrogen receptor-positive disease, all patients eventually develop resistance. van Agthoven et al. (1998) applied an insertional mutagenesis strategy to a breast cancer cell line. Infected cells were subjected to tamoxifen selection, and the resistant clones were screened for a common integration site linked with antiestrogen resistance. By screening a human testis cDNA library with the integration site-specific probe, they obtained a cDNA encoding BCAR3 (breast cancer antiestrogen resistance 3). The deduced 825aa BCAR3 protein contains a putative Src homology 2 (SH2) domain and sequences homologous to yeast CDC48. Northern blot analysis detected abundant expression of a 3.4kb BCAR3 transcript in heart, placenta, skeletal muscle, spleen, prostate, testis, ovary, small intestine, colon, fetal kidney, and several cancer cell lines, but not in nonmalignant breast tissue; a 6kb BCAR3 transcript was also detected in skeletal muscle and heart.

Product Categories/Family for anti-BCAR3 antibody

Antibodies; Oncoproteins

NCBI and Uniprot Product Information

• NCBI GI #: 25058314
• NCBI GeneID: 8412
• Molecular Weight: 82,357 Da
• NCBI Official Full Name: Homo sapiens breast cancer anti-estrogen resistance 3, mRNA
• NCBI Official Synonym Full Names: breast cancer anti-estrogen resistance 3
• NCBI Official Symbol: BCAR3
• NCBI Official Synonym Symbols: NSP2; SH2D3B
• NCBI Protein Information: breast cancer anti-estrogen resistance protein 3
• Protein Family: Breast cancer anti-estrogen resistance protein

NCBI Description

Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers progress to become anti-estrogen resistant. Breast cancer anti-estrogen resistance gene 3 was identified in the search for genes involved in the development of estrogen resistance. The gene encodes a component of intracellular signal transduction that causes estrogen-independent proliferation in human breast cancer cells. The protein contains a putative src homology 2 (SH2) domain, a hall mark of cellular tyrosine kinase signaling molecules, and is partly homologous to the cell division cycle protein CDC48. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2012]