Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Mouse anti-Human BBS7 Monoclonal Antibody | anti-BBS7 antibody
BBS7 (Bardet-Biedl Syndrome 7 Protein, BBS2-like Protein 1, BBS2L1) (PE)
Gene Names
BBS7; BBS2L1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BBS7; Monoclonal Antibody; BBS7 (Bardet-Biedl Syndrome 7 Protein; BBS2-like Protein 1; BBS2L1) (PE); anti-BBS7 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2H6
Specificity
Recognizes human BBS7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-BBS7 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa574-673 from human BBS7 (NP_060660) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQIHEGNTNFLIPEYHCILEEADHLQEEYKKQPAHLERLYG
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Related Product Information for anti-BBS7 antibody
BBS7 is a widely expressed protein with similarity to BBS2. Defects in BBS7 are a cause of Bardet-Biedl syndrome type 7 (BBS7) which is a genetically heterogeneous disorder characterized by usually severe pigmentary retinopathy, early onset obesity, polydactyly, hypogenitalism, renal malformation and mental retardation. The encoded protein may play a role in eye, limb, cardiac and reproductive system development. Two transcript variants encoding distinct isoforms have been identified for this gene.
Product Categories/Family for anti-BBS7 antibody
References
1. BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly. Seo S, Baye LM, Schulz NP, Beck JS, Zhang Q, Slusarski DC, Sheffield VC.Proc Natl Acad Sci U S A. 2010 Jan 4.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
75,446 Da
NCBI Official Full Name
Bardet-Biedl syndrome 7 protein isoform b
NCBI Official Synonym Full Names
Bardet-Biedl syndrome 7
NCBI Official Symbol
BBS7
NCBI Official Synonym Symbols
BBS2L1
NCBI Protein Information
Bardet-Biedl syndrome 7 protein; BBS2-like 1
UniProt Protein Name
Bardet-Biedl syndrome 7 protein
Protein Family
UniProt Gene Name
BBS7
UniProt Synonym Gene Names
BBS2L1
UniProt Entry Name
BBS7_HUMAN
Similar Products
Product Notes
The BBS7 bbs7 (Catalog #AAA6156707) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BBS7 (Bardet-Biedl Syndrome 7 Protein, BBS2-like Protein 1, BBS2L1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BBS7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BBS7 bbs7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BBS7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
