Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against immunogen using MBS6011055 (54.71kD).)

Mouse anti-Human BAMBI Monoclonal Antibody | anti-BAMBI antibody

BAMBI (BMP and Activin Membrane-bound Inhibitor Homolog, Non-metastatic Gene A Protein, NMA, Putative Transmembrane Protein NMA) (HRP)

Gene Names
BAMBI; NMA
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BAMBI; Monoclonal Antibody; BAMBI (BMP and Activin Membrane-bound Inhibitor Homolog; Non-metastatic Gene A Protein; NMA; Putative Transmembrane Protein NMA) (HRP); anti-BAMBI antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C1-1D1
Specificity
Recognizes human BAMBI.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-BAMBI antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant protein corresponding to aa1-260 of BAMBI with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQELTSSKELWFRAAVIAVPIAGGLTLVLLIMLALRMLRSENKRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSNDKILSLVHWGMYSGHG
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against immunogen using MBS6011055 (54.71kD).)

Western Blot (WB) (Western Blot detection against immunogen using MBS6011055 (54.71kD).)

Western Blot (WB)

(Western Blot analysis of BAMBI expression in transfected 293T cell line usingMBS6011055. Lane 1: BAMBI transfected lysate (29.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of BAMBI expression in transfected 293T cell line usingMBS6011055. Lane 1: BAMBI transfected lysate (29.1kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-BAMBI antibody
References
1. Wanninger J, et al., FEBS Lett. 2011 Apr 7. 2. Xavier S, et al., PLoS One. 2010 Sep 24;5(9):e12995. 3. Pils D, et al., Gynecol Oncol. 2010 Feb 25. 4. Tramullas M,et al., J Neurosci. 2010 Jan 27;30(4):1502-11.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
29,108 Da
NCBI Official Full Name
Homo sapiens BMP and activin membrane-bound inhibitor homolog (Xenopus laevis), mRNA
NCBI Official Synonym Full Names
BMP and activin membrane bound inhibitor
NCBI Official Symbol
BAMBI
NCBI Official Synonym Symbols
NMA
NCBI Protein Information
BMP and activin membrane-bound inhibitor homolog

NCBI Description

This gene encodes a transmembrane glycoprotein related to the type I receptors of the transforming growth factor-beta (TGF-beta) family, whose members play important roles in signal transduction in many developmental and pathological processes. The encoded protein however is a pseudoreceptor, lacking an intracellular serine/threonine kinase domain required for signaling. Similar proteins in frog, mouse and zebrafish function as negative regulators of TGF-beta, which has led to the suggestion that the encoded protein may function to limit the signaling range of the TGF-beta family during early embryogenesis. [provided by RefSeq, Jul 2008]

Research Articles on BAMBI

Similar Products

Product Notes

The BAMBI (Catalog #AAA6151392) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BAMBI (BMP and Activin Membrane-bound Inhibitor Homolog, Non-metastatic Gene A Protein, NMA, Putative Transmembrane Protein NMA) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BAMBI can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BAMBI for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BAMBI, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.