Mouse anti-Human BAAT Monoclonal Antibody | anti-BAAT antibody

BAAT (Bile Acid-CoA:Amino Acid N-acyltransferase, BACAT, BAT, Glycine N-choloyltransferase, Long-chain Fatty-acyl-CoA Hydrolase) APC

Cat. Num. AAA6135471

• Gene Names: BAAT; BAT; BACAT
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: BAAT; Monoclonal Antibody; BAAT (Bile Acid-CoA:Amino Acid N-acyltransferase; BACAT; BAT; Glycine N-choloyltransferase; Long-chain Fatty-acyl-CoA Hydrolase) APC; anti-BAAT antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5B6
• Specificity: Recognizes human BAAT.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-BAAT antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa258-355 from human BAAT (NP_001692) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NGTNFPFGIPQVYHGQIHQPLPHSAQLISTNALGLLELYRTFETTQVGASQYLFPIEEAQGQFLFIVGEGDKTINSKAHAEQAIGQLKRHGKNNWTLL
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB)

(BAAT monoclonal antibody, Western Blot analysis of BAAT expression in HepG2.)

Testing Data

(Detection limit for recombinant GST tagged BAAT is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-BAAT antibody

Involved in bile acid metabolism. In liver hepatocytes catalyzes the second step in the conjugation of C24 bile acids (choloneates) to glycine and taurine before excretion into bile canaliculi. The major components of bile are cholic acid and chenodeoxycholic acid. In a first step the bile acids are converted to an acyl-CoA thioester, either in peroxisomes (primary bile acids deriving from the cholesterol pathway), or cytoplasmic at the endoplasmic reticulum (secondary bile acids). May catalyze the conjugation of primary or secondary bile acids, or both. The conjugation increases the detergent properties of bile acids in the intestine, which facilitates lipid and fat-soluble vitamin absorption. In turn, bile acids are deconjugated by bacteria in the intestine and are recycled back to the liver for reconjugation (secondary bile acids). May also act as an acyl-CoA thioesterase that regulates intracellular levels of free fatty acids. In vitro, catalyzes the hydrolysis of long- and very long-chain saturated acyl-CoAs to the free fatty acid and coenzyme A (CoASH), and conjugates glycine to these acyl-CoAs.

Product Categories/Family for anti-BAAT antibody

Antibodies; Enzymes; Acyltransferase

NCBI and Uniprot Product Information

• NCBI GI #: 4502351
• NCBI GeneID: 570
• NCBI Accession #: NP_001692
• NCBI GenBank Nucleotide #: NM_001701
• UniProt Accession #: Q14032
• Molecular Weight: 46kDa
• NCBI Official Full Name: bile acid-CoA:amino acid N-acyltransferase
• NCBI Official Synonym Full Names: bile acid-CoA:amino acid N-acyltransferase
• NCBI Official Symbol: BAAT
• NCBI Official Synonym Symbols: BAT; BACAT
• NCBI Protein Information: bile acid-CoA:amino acid N-acyltransferase
• UniProt Protein Name: Bile acid-CoA:amino acid N-acyltransferase
• Protein Family: Bile acid-CoA:amino acid N-acyltransferase
• UniProt Gene Name: BAAT
• UniProt Synonym Gene Names: BACAT; BAT
• UniProt Entry Name: BAAT_HUMAN

NCBI Description

The protein encoded by this gene is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]