Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to B3GALT2 on HeLa cell. [antibody concentration 10 ug/ml])

Mouse B3GALT2 Monoclonal Antibody | anti-B3GALT2 antibody

B3GALT2 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, Polypeptide 2, BETA3GALT2, GLCT2, beta3Gal-T2) (PE)

Gene Names
B3GALT2; GLCT2; BETA3GALT2; beta3Gal-T2
Applications
ELISA, Immunofluorescence
Purity
Purified
Synonyms
B3GALT2; Monoclonal Antibody; B3GALT2 (UDP-Gal:betaGlcNAc beta 1; 3-galactosyltransferase; Polypeptide 2; BETA3GALT2; GLCT2; beta3Gal-T2) (PE); UDP-Gal:betaGlcNAc beta 1; beta3Gal-T2; anti-B3GALT2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D9
Specificity
Recognizes B3GALT2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
422
Applicable Applications for anti-B3GALT2 antibody
ELISA (EIA), Immunofluorescence (IF)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
B3GALT2 (NP_003774, 324aa-422aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AEKIFKVSLGIRRLHLEDVYVGICLAKLRIDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKHNACANAAKEKAGRYRHRKLH
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to B3GALT2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to B3GALT2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to B3GALT2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to B3GALT2 on HeLa cell. [antibody concentration 10 ug/ml])
Product Categories/Family for anti-B3GALT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
beta-1,3-galactosyltransferase 2
NCBI Official Synonym Full Names
beta-1,3-galactosyltransferase 2
NCBI Official Symbol
B3GALT2
NCBI Official Synonym Symbols
GLCT2; BETA3GALT2; beta3Gal-T2
NCBI Protein Information
beta-1,3-galactosyltransferase 2
UniProt Protein Name
Beta-1,3-galactosyltransferase 2
UniProt Gene Name
B3GALT2
UniProt Entry Name
B3GT2_HUMAN

NCBI Description

This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. This family encodes type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and different acceptor sugars (N-acetylglucosamine, galactose, N-acetylgalactosamine). The beta3GalT genes are distantly related to the Drosophila Brainiac gene and have the protein coding sequence contained in a single exon. The beta3GalT proteins also contain conserved sequences not found in the beta4GalT or alpha3GalT proteins. The carbohydrate chains synthesized by these enzymes are designated as type 1, whereas beta4GalT enzymes synthesize type 2 carbohydrate chains. The ratio of type 1:type 2 chains changes during embryogenesis. By sequence similarity, the beta3GalT genes fall into at least two groups: beta3GalT4 and 4 other beta3GalT genes (beta3GalT1-3, beta3GalT5). This gene encodes a protein that functions in N-linked glycoprotein glycosylation and shows strict donor substrate specificity for UDP-galactose. [provided by RefSeq, Jul 2008]

Uniprot Description

B3GALT2: Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal beta-N- acetylglucosamine (beta-GlcNAc) residue. Can also utilize substrates with a terminal galactose residue, albeit with lower efficiency. Involved in the biosynthesis of the carbohydrate moieties of glycolipids and glycoproteins. Inactive towards substrates with terminal alpha-N-acetylglucosamine (alpha-GlcNAc) or alpha-N-acetylgalactosamine (alpha-GalNAc) residues. Belongs to the glycosyltransferase 31 family.

Protein type: EC 2.4.1.-; Glycan Metabolism - glycosphingolipid biosynthesis - lacto and neolacto series; Transferase; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q31

Cellular Component: Golgi membrane; integral to membrane

Molecular Function: UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity

Biological Process: oligosaccharide biosynthetic process; protein amino acid glycosylation

Similar Products

Product Notes

The B3GALT2 b3galt2 (Catalog #AAA6187037) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's B3GALT2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the B3GALT2 b3galt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "B3GALT2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.