Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged AURKB is approximately 0.03ng/ml as a capture antibody.)

Mouse AURKB Monoclonal Antibody | anti-AURKB antibody

AURKB (Aurora Kinase B, AIK2, AIM-1, AIM1, ARK2, AurB, IPL1, STK12, STK5) (FITC)

Gene Names
AURKB; AIK2; AIM1; ARK2; AurB; IPL1; STK5; AIM-1; ARK-2; STK-1; STK12; PPP1R48; aurkb-sv1; aurkb-sv2
Applications
Immunofluorescence, Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
AURKB; Monoclonal Antibody; AURKB (Aurora Kinase B; AIK2; AIM-1; AIM1; ARK2; AurB; IPL1; STK12; STK5) (FITC); Aurora Kinase B; STK5; anti-AURKB antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6H7
Specificity
Recognizes AURKB.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
344
Applicable Applications for anti-AURKB antibody
Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
AURKB (AAH09751, 1aa-90aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTIDDFEIGRPLGKGKFGN
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged AURKB is approximately 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged AURKB is approximately 0.03ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to AURKB on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to AURKB on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to AURKB on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to AURKB on HeLa cell. [antibody concentration 10 ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of AURKB transfected lysate using anti-AURKB monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with AURKB monoclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of AURKB transfected lysate using anti-AURKB monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with AURKB monoclonal antibody.)

Western Blot (WB)

(Western Blot analysis of AURKB expression in transfected 293T cell line by AURKB monoclonal antibody (M03), clone 6H7.Lane 1: AURKB transfected lysate (Predicted MW: 39.3 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AURKB expression in transfected 293T cell line by AURKB monoclonal antibody (M03), clone 6H7.Lane 1: AURKB transfected lysate (Predicted MW: 39.3 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-AURKB antibody
Chromosomal segregation during mitosis as well as meiosis is regulated by kinases and phosphatases. The Aurora kinases associate with microtubules during chromosome movement and segregation. Aurora kinase B localizes to microtubules near kinetochores, specifically to the specialized microtubules called K-fibers, and Aurora kinase A (MIM 603072) localizes to centrosomes (Lampson et al., 2004 [PubMed 14767480]). [supplied by OMIM]
Product Categories/Family for anti-AURKB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Aurora kinase B
NCBI Official Synonym Full Names
aurora kinase B
NCBI Official Symbol
AURKB
NCBI Official Synonym Symbols
AIK2; AIM1; ARK2; AurB; IPL1; STK5; AIM-1; ARK-2; STK-1; STK12; PPP1R48; aurkb-sv1; aurkb-sv2
NCBI Protein Information
aurora kinase B
Protein Family

NCBI Description

This gene encodes a member of the aurora kinase subfamily of serine/threonine kinases. The genes encoding the other two members of this subfamily are located on chromosomes 19 and 20. These kinases participate in the regulation of alignment and segregation of chromosomes during mitosis and meiosis through association with microtubules. A pseudogene of this gene is located on chromosome 8. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2015]

Research Articles on AURKB

Similar Products

Product Notes

The AURKB (Catalog #AAA6175051) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's AURKB can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AURKB for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AURKB, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.