Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human ATP9A Monoclonal Antibody | anti-ATP9A antibody

ATP9A (Probable Phospholipid-transporting ATPase IIA, ATPase Class II Type 9A, ATPIIA, KIAA0611) (AP)

Gene Names
ATP9A; ATPIIA
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ATP9A; Monoclonal Antibody; ATP9A (Probable Phospholipid-transporting ATPase IIA; ATPase Class II Type 9A; ATPIIA; KIAA0611) (AP); anti-ATP9A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G2
Specificity
Recognizes human ATP9A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
7862
Applicable Applications for anti-ATP9A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa358-456 from ATP9A (NP_006036) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YSWVIRRDSKIPGTVVRSSTIPEQLGRISYLLTDKTGTLTQNEMIFKRLHLGTVAYGLDSMDEVQSHIFSIYTQQSQDPPAQKGPTLTTKVRRTMSSRV
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ATP9A on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ATP9A on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-ATP9A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens ATPase phospholipid transporting 9A (putative) (ATP9A), mRNA
NCBI Official Synonym Full Names
ATPase phospholipid transporting 9A (putative)
NCBI Official Symbol
ATP9A
NCBI Official Synonym Symbols
ATPIIA
NCBI Protein Information
probable phospholipid-transporting ATPase IIA
UniProt Protein Name
Probable phospholipid-transporting ATPase IIA
UniProt Gene Name
ATP9A
UniProt Synonym Gene Names
ATPIIA; KIAA0611
UniProt Entry Name
ATP9A_HUMAN

Uniprot Description

Catalytic activity: ATP + H2O + phospholipid(Side 1) = ADP + phosphate + phospholipid(Side 2).

Subcellular location: Early endosome membrane; Multi-pass membrane protein. Recycling endosome. Golgi apparatus › trans-Golgi network membrane. Note: Efficient exit from the endoplasmic reticulum does not require TMEM30A, nor TMEM30B. Ref.5

Sequence similarities: Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IV subfamily. [View classification]

Sequence caution: The sequence BAD18775.1 differs from that shown. Reason: Erroneous initiation. The sequence CAI18889.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI19203.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI22924.1 differs from that shown. Reason: Erroneous gene model prediction.

Research Articles on ATP9A

Similar Products

Product Notes

The ATP9A atp9a (Catalog #AAA6130144) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ATP9A (Probable Phospholipid-transporting ATPase IIA, ATPase Class II Type 9A, ATPIIA, KIAA0611) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP9A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATP9A atp9a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATP9A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.