Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.08kD).)

Mouse anti-Human ATP7B Monoclonal Antibody | anti-ATP7B antibody

ATP7B (Copper-transporting ATPase 2, Copper Pump 2, Wilson Disease-associated Protein, WND/140kD, WND, WC1, PWD) (Biotin)

Gene Names
ATP7B; WD; PWD; WC1; WND
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ATP7B; Monoclonal Antibody; ATP7B (Copper-transporting ATPase 2; Copper Pump 2; Wilson Disease-associated Protein; WND/140kD; WND; WC1; PWD) (Biotin); anti-ATP7B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3E10
Specificity
Recognizes human ATP7B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1465
Applicable Applications for anti-ATP7B antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1372-1465 from human ATP7B (NP_000044) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QLKCYKKPDLERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEEQYI
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.08kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.08kD).)

Western Blot (WB)

(ATP7B monoclonal antibody. Western Blot analysis of ATP7B expression in human colon.)

Western Blot (WB) (ATP7B monoclonal antibody. Western Blot analysis of ATP7B expression in human colon.)

Testing Data

(Detection limit for recombinant GST tagged ATP7B is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ATP7B is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-ATP7B antibody
ATP7B is a member of the P-type cation transport ATPase family and a protein with several membrane-spanning domains, an ATPase consensus sequence, a hinge domain, a phosphorylation site, and at least 2 putative copper-binding sites. This protein functions as a monomer, exporting copper out of the cells, such as the efflux of hepatic copper into the bile.
Product Categories/Family for anti-ATP7B antibody
References
1. Characterization of Sandwich-Cultured Hepatocytes as an In Vitro Model to Assess the Hepatobiliary Disposition of Copper. Ansede JH, Wright MR, St Claire RL, Hart RW, Gefroh HA, Brouwer KR.Drug Metab Dispos. 2009 May;37(5):969-76. Epub 2009 Feb 23.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
540
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
copper-transporting ATPase 2 isoform a
NCBI Official Synonym Full Names
ATPase copper transporting beta
NCBI Official Symbol
ATP7B
NCBI Official Synonym Symbols
WD; PWD; WC1; WND
NCBI Protein Information
copper-transporting ATPase 2
UniProt Protein Name
Copper-transporting ATPase 2
UniProt Gene Name
ATP7B
UniProt Synonym Gene Names
PWD; WC1; WND
UniProt Entry Name
ATP7B_HUMAN

NCBI Description

This gene is a member of the P-type cation transport ATPase family and encodes a protein with several membrane-spanning domains, an ATPase consensus sequence, a hinge domain, a phosphorylation site, and at least 2 putative copper-binding sites. This protein is a monomer, and functions as a copper-transporting ATPase which exports copper out of the cells, such as the efflux of hepatic copper into the bile. Alternate transcriptional splice variants, encoding different isoforms with distinct cellular localizations, have been characterized. Mutations in this gene have been associated with Wilson disease which is characterized by copper accumulation. [provided by RefSeq, Dec 2019]

Uniprot Description

ATP7B: Involved in the export of copper out of the cells, such as the efflux of hepatic copper into the bile. Monomer. Interacts with COMMD1/MURR1. Most abundant in liver and kidney and also found in brain. Isoform 2 is expressed in brain but not in liver. The cleaved form WND/140 kDa is found in liver cell lines and other tissues. Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IB subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter; Vesicle; Membrane protein, integral; Transporter, ion channel; Hydrolase; Membrane protein, multi-pass; EC 3.6.3.54

Chromosomal Location of Human Ortholog: 13q14.3

Cellular Component: Golgi membrane; membrane; mitochondrion; basolateral plasma membrane; perinuclear region of cytoplasm; integral to plasma membrane; cytoplasmic membrane-bound vesicle; late endosome; trans-Golgi network

Molecular Function: protein binding; copper ion binding; copper-exporting ATPase activity; ATP binding

Biological Process: lactation; cellular copper ion homeostasis; response to copper ion; metabolic process; cellular zinc ion homeostasis; sequestering of calcium ion; copper ion import; copper ion transport; copper ion export; transmembrane transport; intracellular copper ion transport

Disease: Wilson Disease

Research Articles on ATP7B

Similar Products

Product Notes

The ATP7B atp7b (Catalog #AAA6140747) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ATP7B (Copper-transporting ATPase 2, Copper Pump 2, Wilson Disease-associated Protein, WND/140kD, WND, WC1, PWD) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP7B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATP7B atp7b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATP7B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.