Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (42.61kD).)

Mouse anti-Human ATP2C1 Monoclonal Antibody | anti-ATP2C1 antibody

ATP2C1 (KIAA1347, PMR1L, Calcium-transporting ATPase Type 2C Member 1, ATP-dependent Ca(2+) Pump PMR1) (PE)

Gene Names
ATP2C1; HHD; BCPM; PMR1; SPCA1; hSPCA1; ATP2C1A
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ATP2C1; Monoclonal Antibody; ATP2C1 (KIAA1347; PMR1L; Calcium-transporting ATPase Type 2C Member 1; ATP-dependent Ca(2+) Pump PMR1) (PE); anti-ATP2C1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1, lambda
Clone Number
2G1
Specificity
Recognizes human ATP2C1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ATP2C1 antibody
ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa119-269 from human ATP2C1 (AAH28139) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (42.61kD).)

Western Blot (WB) (Western Blot detection against Immunogen (42.61kD).)

Western Blot (WB)

(Western Blot analysis of ATP2C1 expression in transfected 293T cell line by ATP2C1 monoclonal antibody. Lane 1: ATP2C1 transfected lysate (100.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ATP2C1 expression in transfected 293T cell line by ATP2C1 monoclonal antibody. Lane 1: ATP2C1 transfected lysate (100.6kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ATP2C1 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ATP2C1 on HeLa cell. [antibody concentration 10ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of ATP2C1 transfected lysate using ATP2C1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ATP2C1 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of ATP2C1 transfected lysate using ATP2C1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ATP2C1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged ATP2C1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ATP2C1 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of ATP2C1 over-expressed 293 cell line, cotransfected with ATP2C1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ATP2C1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of ATP2C1 over-expressed 293 cell line, cotransfected with ATP2C1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ATP2C1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB)

(ATP2C1 monoclonal antibody Western Blot analysis of ATP2C1 expression in HeLa.)

Western Blot (WB) (ATP2C1 monoclonal antibody Western Blot analysis of ATP2C1 expression in HeLa.)
Product Categories/Family for anti-ATP2C1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
104,032 Da
NCBI Official Full Name
Homo sapiens ATPase, Ca++ transporting, type 2C, member 1, mRNA
NCBI Official Synonym Full Names
ATPase secretory pathway Ca2+ transporting 1
NCBI Official Symbol
ATP2C1
NCBI Official Synonym Symbols
HHD; BCPM; PMR1; SPCA1; hSPCA1; ATP2C1A
NCBI Protein Information
calcium-transporting ATPase type 2C member 1

NCBI Description

The protein encoded by this gene belongs to the family of P-type cation transport ATPases. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium ions. Defects in this gene cause Hailey-Hailey disease, an autosomal dominant disorder. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011]

Research Articles on ATP2C1

Similar Products

Product Notes

The ATP2C1 (Catalog #AAA6156640) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ATP2C1 (KIAA1347, PMR1L, Calcium-transporting ATPase Type 2C Member 1, ATP-dependent Ca(2+) Pump PMR1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP2C1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATP2C1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATP2C1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.