Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ATP1A3 Monoclonal Antibody | anti-Atp1a3 antibody

ATP1A3 (Sodium/Potassium-transporting ATPase Subunit alpha-3, Na(+)/K(+) ATPase alpha-3 Subunit, Na(+)/K(+) ATPase alpha(III) Subunit, Sodium Pump Subunit alpha-3)

Gene Names
Atp1a3; Atpa-2
Reactivity
Human
Applications
ELISA
Purity
Ascites
Ascites
Synonyms
ATP1A3; Monoclonal Antibody; ATP1A3 (Sodium/Potassium-transporting ATPase Subunit alpha-3; Na(+)/K(+) ATPase alpha-3 Subunit; Na(+)/K(+) ATPase alpha(III) Subunit; Sodium Pump Subunit alpha-3); Anti -ATP1A3 (Sodium/Potassium-transporting ATPase Subunit alpha-3; anti-Atp1a3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgM,k
Clone Number
1D2
Specificity
Recognizes human ATP1A3.
Purity/Purification
Ascites
Ascites
Form/Format
Supplied as a liquid in ascites fluid.
Sequence
NWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPY
Applicable Applications for anti-Atp1a3 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa879-984 from human ATP1A3 (NM_152296) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-Atp1a3 antibody
This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium ions, providing the energy for active transport of various nutrients.
Product Categories/Family for anti-Atp1a3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
111,692 Da
NCBI Official Full Name
Atp1a3 protein
NCBI Official Synonym Full Names
ATPase, Na+/K+ transporting, alpha 3 polypeptide
NCBI Official Symbol
Atp1a3
NCBI Official Synonym Symbols
Atpa-2
NCBI Protein Information
sodium/potassium-transporting ATPase subunit alpha-3; sodium pump subunit alpha-3; Na(+)/K(+) ATPase alpha-3 subunit; Na(+)/K(+) ATPase alpha(III) subunit
UniProt Protein Name
Sodium/potassium-transporting ATPase subunit alpha-3
UniProt Gene Name
Atp1a3
UniProt Synonym Gene Names
Na(+)/K(+) ATPase alpha-3 subunit
UniProt Entry Name
AT1A3_MOUSE

Uniprot Description

Function: This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium ions, providing the energy for active transport of various nutrients

By similarity.

Catalytic activity: ATP + H2O + Na+(In) + K+(Out) = ADP + phosphate + Na+(Out) + K+(In).

Subunit structure: Composed of three subunits: alpha (catalytic), beta and gamma

By similarity.

Subcellular location: Cell membrane; Multi-pass membrane protein

By similarity.

Sequence similarities: Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIC subfamily. [View classification]

Research Articles on Atp1a3

Similar Products

Product Notes

The Atp1a3 atp1a3 (Catalog #AAA647177) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ATP1A3 (Sodium/Potassium-transporting ATPase Subunit alpha-3, Na(+)/K(+) ATPase alpha-3 Subunit, Na(+)/K(+) ATPase alpha(III) Subunit, Sodium Pump Subunit alpha-3) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP1A3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the Atp1a3 atp1a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NWDDRTVNDL EDSYGQQWTY EQRKVVEFTC HTAFFVSIVV VQWADLIICK TRRNSVFQQG MKNKILIFGL FEETALAAFL SYCPGMDVAL RMYPLKPSWW FCAFPY. It is sometimes possible for the material contained within the vial of "ATP1A3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.