Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.22kD).)

Mouse anti-Human ATOX1 Monoclonal Antibody | anti-ATOX1 antibody

ATOX1 (Copper Transport Protein ATOX1, Metal Transport Protein ATX1, HAH1) (HRP)

Gene Names
ATOX1; ATX1; HAH1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ATOX1; Monoclonal Antibody; ATOX1 (Copper Transport Protein ATOX1; Metal Transport Protein ATX1; HAH1) (HRP); anti-ATOX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E6
Specificity
Recognizes human ATOX1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-ATOX1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-68 from human ATOX1 (NP_004036) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.22kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.22kD).)

Western Blot (WB)

(ATOX1 monoclonal antibody. Western Blot analysis of ATOX1 expression in human liver.)

Western Blot (WB) (ATOX1 monoclonal antibody. Western Blot analysis of ATOX1 expression in human liver.)

Western Blot (WB)

(ATOX1 monoclonal antibody. Western Blot analysis of ATOX1 expression in COLO 320 HSR.)

Western Blot (WB) (ATOX1 monoclonal antibody. Western Blot analysis of ATOX1 expression in COLO 320 HSR.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ATOX1 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ATOX1 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ATOX1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ATOX1 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-ATOX1 antibody
Binds and deliver cytosolic copper to the copper ATPase proteins. May be important in cellular antioxidant defense.
Product Categories/Family for anti-ATOX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
475
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9.5 kDa (88aa), confirmed by MALDI-TOF.
NCBI Official Full Name
copper transport protein ATOX1
NCBI Official Synonym Full Names
antioxidant 1 copper chaperone
NCBI Official Symbol
ATOX1
NCBI Official Synonym Symbols
ATX1; HAH1
NCBI Protein Information
copper transport protein ATOX1
UniProt Protein Name
Copper transport protein ATOX1
Protein Family
UniProt Gene Name
ATOX1
UniProt Synonym Gene Names
HAH1
UniProt Entry Name
ATOX1_HUMAN

NCBI Description

This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. [provided by RefSeq, Jul 2008]

Uniprot Description

ATOX1: Could bind and deliver cytosolic copper to the copper ATPase proteins. May be important in cellular antioxidant defense. Belongs to the ATX1 family.

Protein type: Carrier

Chromosomal Location of Human Ortholog: 5q32

Cellular Component: cytosol

Molecular Function: metallochaperone activity; copper ion transmembrane transporter activity; copper ion binding; copper chaperone activity; copper-dependent protein binding

Biological Process: response to reactive oxygen species; cellular copper ion homeostasis; response to oxidative stress; copper ion transport; intracellular copper ion transport

Research Articles on ATOX1

Similar Products

Product Notes

The ATOX1 atox1 (Catalog #AAA6151332) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ATOX1 (Copper Transport Protein ATOX1, Metal Transport Protein ATX1, HAH1) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATOX1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATOX1 atox1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATOX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.