Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ATOH1 on HeLa cell. [antibody concentration 10 ug/ml])

Mouse ATOH1 Monoclonal Antibody | anti-ATOH1 antibody

ATOH1 (Atonal Homolog 1 (Drosophila), ATH1, HATH1, MATH-1, bHLHa14) (FITC)

Gene Names
ATOH1; ATH1; HATH1; MATH-1; bHLHa14
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified
Synonyms
ATOH1; Monoclonal Antibody; ATOH1 (Atonal Homolog 1 (Drosophila); ATH1; HATH1; MATH-1; bHLHa14) (FITC); Atonal Homolog 1 (Drosophila); bHLHa14; anti-ATOH1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG
Clone Number
1C5
Specificity
Recognizes ATOH1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-ATOH1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ATOH1 (NP_005163.1, 266aa-354aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ATOH1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ATOH1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ATOH1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ATOH1 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-ATOH1 antibody
This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. [provided by RefSeq]
Product Categories/Family for anti-ATOH1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
474
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,160 Da
NCBI Official Full Name
protein atonal homolog 1
NCBI Official Synonym Full Names
atonal homolog 1 (Drosophila)
NCBI Official Symbol
ATOH1
NCBI Official Synonym Symbols
ATH1; HATH1; MATH-1; bHLHa14
NCBI Protein Information
protein atonal homolog 1; class A basic helix-loop-helix protein 14; helix-loop-helix protein hATH-1
UniProt Protein Name
Protein atonal homolog 1
Protein Family
UniProt Gene Name
ATOH1
UniProt Synonym Gene Names
ATH1; BHLHA14; bHLHa14; hATH1
UniProt Entry Name
ATOH1_HUMAN

NCBI Description

This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. [provided by RefSeq, Jul 2008]

Uniprot Description

ATOH1: a conserved transcription factor that regulates secretory cell differentiation in colonic epithelium. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. May play a role in the differentiation of subsets of neural cells by activating E box- dependent transcription . Efficient DNA binding requires dimerization with another bHLH protein. Loss of ATOH1 expression in the colon of mice initiates colon cancer. ATOH1 has been silenced in most human colon cancers, and reactivation of this gene in cultured human colon cancer cells is anti-proliferative and induces apoptosis.

Protein type: DNA-binding; Transcription factor; Cell development/differentiation

Chromosomal Location of Human Ortholog: 4q22

Cellular Component: nucleus

Molecular Function: protein dimerization activity; chromatin DNA binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; axon guidance; inner ear morphogenesis; central nervous system development; auditory receptor cell fate determination; neuron migration; positive regulation of transcription from RNA polymerase II promoter; positive regulation of auditory receptor cell differentiation; auditory receptor cell fate specification; cerebral cortex development; positive regulation of neuron differentiation; negative regulation of apoptosis

Research Articles on ATOH1

Similar Products

Product Notes

The ATOH1 atoh1 (Catalog #AAA6175302) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ATOH1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATOH1 atoh1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATOH1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.