Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ATG5 monoclonal antibody (M05), clone 1E7. Western Blot analysis of ATG5 expression in Jurkat (Cat # L017V1).)

Mouse ATG5 Monoclonal Antibody | anti-ATG5 antibody

ATG5 (ATG5 autophagy Related 5 Homolog (S. cerevisiae), APG5, APG5-LIKE, APG5L, ASP, hAPG5) (PE)

Gene Names
ATG5; ASP; APG5; APG5L; hAPG5; SCAR25; APG5-LIKE
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
ATG5; Monoclonal Antibody; ATG5 (ATG5 autophagy Related 5 Homolog (S. cerevisiae); APG5; APG5-LIKE; APG5L; ASP; hAPG5) (PE); ATG5 autophagy Related 5 Homolog (S. cerevisiae); hAPG5; anti-ATG5 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
10000000
Specificity
Recognizes ATG5.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
275
Applicable Applications for anti-ATG5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ATG5 (AAH02699, 176aa-275aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(ATG5 monoclonal antibody (M05), clone 1E7. Western Blot analysis of ATG5 expression in Jurkat (Cat # L017V1).)

Western Blot (WB) (ATG5 monoclonal antibody (M05), clone 1E7. Western Blot analysis of ATG5 expression in Jurkat (Cat # L017V1).)

Western Blot (WB)

(ATG5 monoclonal antibody (M05), clone 1E7. Western Blot analysis of ATG5 expression in NIH/3T3.)

Western Blot (WB) (ATG5 monoclonal antibody (M05), clone 1E7. Western Blot analysis of ATG5 expression in NIH/3T3.)

Western Blot (WB)

(ATG5 monoclonal antibody (M05), clone 1E7. Western Blot analysis of ATG5 expression in Raw 264.7.)

Western Blot (WB) (ATG5 monoclonal antibody (M05), clone 1E7. Western Blot analysis of ATG5 expression in Raw 264.7.)
Related Product Information for anti-ATG5 antibody
Mouse monoclonal antibody raised against a partial recombinant ATG5.
Product Categories/Family for anti-ATG5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
ATG5 protein
NCBI Official Synonym Full Names
autophagy related 5
NCBI Official Symbol
ATG5
NCBI Official Synonym Symbols
ASP; APG5; APG5L; hAPG5; SCAR25; APG5-LIKE
NCBI Protein Information
autophagy protein 5
Protein Family

NCBI Description

The protein encoded by this gene, in combination with autophagy protein 12, functions as an E1-like activating enzyme in a ubiquitin-like conjugating system. The encoded protein is involved in several cellular processes, including autophagic vesicle formation, mitochondrial quality control after oxidative damage, negative regulation of the innate antiviral immune response, lymphocyte development and proliferation, MHC II antigen presentation, adipocyte differentiation, and apoptosis. Several transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq, Sep 2015]

Research Articles on ATG5

Similar Products

Product Notes

The ATG5 (Catalog #AAA6186108) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ATG5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATG5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATG5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.