Western Blot (WB)
(Western Blot detection against Immunogen using MBS6001808 (33.37kD).)
Mouse anti-Human ATCAY Monoclonal Antibody | anti-ATCAY antibody
ATCAY (Caytaxin, Ataxia Cayman Type Protein, BNIP-2-homolgy, BNIP-H, KIAA1872)
Gene Names
ATCAY; caytaxin
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
ATCAY; Monoclonal Antibody; ATCAY (Caytaxin; Ataxia Cayman Type Protein; BNIP-2-homolgy; BNIP-H; KIAA1872); Anti -ATCAY (Caytaxin; anti-ATCAY antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4F2
Specificity
Recognizes human ATCAY.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Concentration
1 mg/mL (varies by lot)
Sequence
TTEATLRMENVDVKEEWQDEDLPRPLPEETGVELLGSPVEDTSSPPNTLNFNGAHRKRKTLVAPEI
Applicable Applications for anti-ATCAY antibody
Suitable for use in ELISA and Western Blot.
Application Notes
Other applications not tested.
Immunogen
Partial recombinant corresponding to aa3-69 from human ATCAY (NP_149053) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen using MBS6001808 (33.37kD).)
Western Blot (WB)
(Western Blot detection against Immunogen using MBS6001808 (33.37kD).)
Western Blot (WB)
(Western Blot analysis of ATCAY expression in IMR-32 using MBS6001808 .)
Western Blot (WB)
(Western Blot analysis of ATCAY expression in IMR-32 using MBS6001808 .)
Testing Data
(Detection limit for recombinant GST tagged ATCAY is 0.03ng/ml using MBS6001808 as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged ATCAY is 0.03ng/ml using MBS6001808 as a capture antibody.)
Product Categories/Family for anti-ATCAY antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
ATCAY protein
NCBI Official Synonym Full Names
ataxia, cerebellar, Cayman type<
NCBI Official Symbol
ATCAY
NCBI Official Synonym Symbols
caytaxin
NCBI Protein Information
caytaxin; ataxia, cerebellar, Cayman type (caytaxin)
Protein Family
Similar Products
Product Notes
The ATCAY (Catalog #AAA6001808) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ATCAY (Caytaxin, Ataxia Cayman Type Protein, BNIP-2-homolgy, BNIP-H, KIAA1872) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATCAY can be used in a range of immunoassay formats including, but not limited to, Suitable for use in ELISA and Western Blot. Other applications not tested. Researchers should empirically determine the suitability of the ATCAY for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TTEATLRMEN VDVKEEWQDE DLPRPLPEET GVELLGSPVE DTSSPPNTLN FNGAHRKRKT LVAPEI. It is sometimes possible for the material contained within the vial of "ATCAY, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
