Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence to ASS1 on HeLa cells using (10ug/ml).)

Mouse anti-Human ASS1 Monoclonal Antibody | anti-ASS1 antibody

ASS1 (Argininosuccinate Synthetase 1, ASS, CTLN1) (PE)

Gene Names
ASS1; ASS; CTLN1
Reactivity
Human
Applications
Immunofluorescence
Purity
Purified
Synonyms
ASS1; Monoclonal Antibody; ASS1 (Argininosuccinate Synthetase 1; ASS; CTLN1) (PE); Argininosuccinate Synthetase 1; CTLN1; anti-ASS1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D2
Specificity
Recognizes human ASS1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ASS1 antibody
FLISA, Immunofluorescence (IF)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa121-220 of human ASS1 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KGNDQVRFELSCYSLAPQIKVIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTP
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence to ASS1 on HeLa cells using (10ug/ml).)

Immunofluorescence (IF) (Immunofluorescence to ASS1 on HeLa cells using (10ug/ml).)

Testing Data

Testing Data
Related Product Information for anti-ASS1 antibody
The protein encoded by this gene catalyzes the penultimate step of the arginine biosynthetic pathway. There are approximately 10 to 14 copies of this gene including the pseudogenes scattered across the human genome, among which the one located on chromosome 9 appears to be the only functional gene for argininosuccinate synthetase. Mutations in the chromosome 9 copy of ASS cause citrullinemia. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-ASS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
445
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,530 Da
NCBI Official Full Name
argininosuccinate synthase
NCBI Official Synonym Full Names
argininosuccinate synthase 1
NCBI Official Symbol
ASS1
NCBI Official Synonym Symbols
ASS; CTLN1
NCBI Protein Information
argininosuccinate synthase; argininosuccinate synthetase 1; citrulline--aspartate ligase; citrulline-aspartate ligase
UniProt Protein Name
Argininosuccinate synthase
UniProt Gene Name
ASS1
UniProt Synonym Gene Names
ASS
UniProt Entry Name
ASSY_HUMAN

NCBI Description

The protein encoded by this gene catalyzes the penultimate step of the arginine biosynthetic pathway. There are approximately 10 to 14 copies of this gene including the pseudogenes scattered across the human genome, among which the one located on chromosome 9 appears to be the only functional gene for argininosuccinate synthetase. Mutations in the chromosome 9 copy of this gene cause citrullinemia. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Aug 2012]

Uniprot Description

ASS1: Defects in ASS1 are the cause of citrullinemia type 1 (CTLN1). Citrullinemia belongs to the urea cycle disorders. It is an autosomal recessive disease characterized primarily by elevated serum and urine citrulline levels. Ammonia intoxication is another manifestation. CTLN1 usually manifests in the first few days of life. Affected infants appear normal at birth, but as ammonia builds up in the body they present symptoms such as lethargy, poor feeding, vomiting, seizures and loss of consciousness. Less commonly, a milder CTLN1 form can develop later in childhood or adulthood. Belongs to the argininosuccinate synthase family. Type 1 subfamily.

Protein type: Amino Acid Metabolism - arginine and proline; Amino Acid Metabolism - alanine, aspartate and glutamate; Mitochondrial; EC 6.3.4.5; Endoplasmic reticulum; Ligase

Chromosomal Location of Human Ortholog: 9q34.1

Cellular Component: mitochondrial outer membrane; lysosome; endoplasmic reticulum; cytoplasm; perikaryon; nucleus; cytosol

Molecular Function: amino acid binding; toxin binding; protein binding; argininosuccinate synthase activity; ATP binding

Biological Process: response to drug; positive regulation of nitric oxide biosynthetic process; arginine biosynthetic process; response to mycotoxin; citrulline metabolic process; liver development; response to estradiol stimulus; response to zinc ion; acute-phase response; midgut development; aspartate metabolic process; kidney development; argininosuccinate metabolic process; response to nutrient; urea cycle; aging

Disease: Citrullinemia, Classic

Research Articles on ASS1

Similar Products

Product Notes

The ASS1 ass1 (Catalog #AAA6187341) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ASS1 (Argininosuccinate Synthetase 1, ASS, CTLN1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ASS1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ASS1 ass1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ASS1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.