Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged is 1ng/ml using as a capture antibody.)

Mouse anti-Human ASMT Monoclonal Antibody | anti-ASMT antibody

ASMT (Acetylserotonin O-Methyltransferase, Hydroxyindole O-methyltransferase, HIOMT) (MaxLight 490)

Gene Names
ASMT; ASMTY; HIOMT; HIOMTY
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ASMT; Monoclonal Antibody; ASMT (Acetylserotonin O-Methyltransferase; Hydroxyindole O-methyltransferase; HIOMT) (MaxLight 490); anti-ASMT antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F8
Specificity
Recognizes human ASMT.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-ASMT antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa71-170 from human ASMT with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRS
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged is 1ng/ml using as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged is 1ng/ml using as a capture antibody.)
Related Product Information for anti-ASMT antibody
Produces melatonin (N-acetyl-5-methoxytryptamine) from N-acetylserotonin.
Product Categories/Family for anti-ASMT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
438
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
acetylserotonin O-methyltransferase isoform 1
NCBI Official Synonym Full Names
acetylserotonin O-methyltransferase
NCBI Official Symbol
ASMT
NCBI Official Synonym Symbols
ASMTY; HIOMT; HIOMTY
NCBI Protein Information
acetylserotonin O-methyltransferase
UniProt Protein Name
Acetylserotonin O-methyltransferase
UniProt Gene Name
ASMT
UniProt Synonym Gene Names
HIOMT
UniProt Entry Name
ASMT_HUMAN

NCBI Description

This gene belongs to the methyltransferase superfamily, and is located in the pseudoautosomal region (PAR) at the end of the short arms of the X and Y chromosomes. The encoded enzyme catalyzes the final reaction in the synthesis of melatonin, and is abundant in the pineal gland. Alternatively spliced transcript variants have been noted for this gene. [provided by RefSeq, Jan 2010]

Uniprot Description

ASMT: Produces melatonin (N-acetyl-5-methoxytryptamine) from N-acetylserotonin. Belongs to the methyltransferase superfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Methyltransferase; EC 2.1.1.4; Amino Acid Metabolism - tryptophan

Chromosomal Location of Human Ortholog: Xp22.3 or Yp11.3

Cellular Component: cytosol

Molecular Function: identical protein binding; protein homodimerization activity; O-methyltransferase activity; acetylserotonin O-methyltransferase activity

Biological Process: methylation; melatonin biosynthetic process; translation; indolalkylamine biosynthetic process

Research Articles on ASMT

Similar Products

Product Notes

The ASMT asmt (Catalog #AAA6199636) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ASMT (Acetylserotonin O-Methyltransferase, Hydroxyindole O-methyltransferase, HIOMT) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ASMT can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ASMT asmt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ASMT, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.