Mouse anti-Human ASK1 Monoclonal Antibody | anti-ASK1 antibody

ASK1 (Apoptosis Signal-regulating Kinase 1, ASK-1, Mitogen-activated Protein Kinase Kinase Kinase 5, MAP3K5, MAPKKK5, MAPK/ERK Kinase Kinase 5, MEK Kinase 5, MEKK 5, MEKK5) (HRP)

Cat. Num. AAA6151308

• Gene Names: MAP3K5; ASK1; MEKK5; MAPKKK5
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ASK1; Monoclonal Antibody; ASK1 (Apoptosis Signal-regulating Kinase 1; ASK-1; Mitogen-activated Protein Kinase Kinase Kinase 5; MAP3K5; MAPKKK5; MAPK/ERK Kinase Kinase 5; MEK Kinase 5; MEKK 5; MEKK5) (HRP); anti-ASK1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1, lambda
• Clone Number: 2D11
• Specificity: Recognizes human MAP3K5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 4578

• Applicable Applications for anti-ASK1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1231-1374 from human MAP3K5 (AAH54503) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SHDSQSAHRSLNVQLGRMKIETNRLLEELVRKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (41.58kD).)

Western Blot (WB)

(MAP3K5 monoclonal antibody Western Blot analysis of MAP3K5 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of MAP3K5 expression in transfected 293T cell line by MAP3K5 monoclonal antibody. Lane 1: MAP3K5 transfected lysate (155kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MAP3K5 on A-431 cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MAP3K5 is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-ASK1 antibody

Mitogen-activated protein (MAP) kinase cascades are activated in response to various extracellular stimuli, including cytokines, growth factors and environmental stresses. A novel MAP kinase kinase kinase (MAPKKK) was recently identified and designated ASK1 (for apoptosis signal-regulating kinase 1) and MAPKKK5. ASK1 activated two different subgroups of MAPKK, MKK4 and MKK6, which in turn activated c-Jun N-terminal kinase (JNK) and p38 MAP kinase, respectively. ASK1/MAPKKK5 is activated by TNFR and Fas through the interaction with members of the TRAF family and Fas-associated protein Daxx. Overexpression of ASK1 induced apoptotic cell death, and a catalytically inactive form of ASK1 inhibited TNF-a-induced apoptosis. ASK1 is expressed in variety of tissues and cell lines.

Product Categories/Family for anti-ASK1 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 34193967
• NCBI GeneID: 4217
• NCBI Official Full Name: Homo sapiens mitogen-activated protein kinase kinase kinase 5, mRNA
• NCBI Official Synonym Full Names: mitogen-activated protein kinase kinase kinase 5
• NCBI Official Symbol: MAP3K5
• NCBI Official Synonym Symbols: ASK1; MEKK5; MAPKKK5
• NCBI Protein Information: mitogen-activated protein kinase kinase kinase 5
• Protein Family: DASH complex

NCBI Description

Mitogen-activated protein kinase (MAPK) signaling cascades include MAPK or extracellular signal-regulated kinase (ERK), MAPK kinase (MKK or MEK), and MAPK kinase kinase (MAPKKK or MEKK). MAPKK kinase/MEKK phosphorylates and activates its downstream protein kinase, MAPK kinase/MEK, which in turn activates MAPK. The kinases of these signaling cascades are highly conserved, and homologs exist in yeast, Drosophila, and mammalian cells. MAPKKK5 contains 1,374 amino acids with all 11 kinase subdomains. Northern blot analysis shows that MAPKKK5 transcript is abundantly expressed in human heart and pancreas. The MAPKKK5 protein phosphorylates and activates MKK4 (aliases SERK1, MAPKK4) in vitro, and activates c-Jun N-terminal kinase (JNK)/stress-activated protein kinase (SAPK) during transient expression in COS and 293 cells; MAPKKK5 does not activate MAPK/ERK. [provided by RefSeq, Jul 2008]