Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ART3 Monoclonal Antibody | anti-ART3 antibody

ART3 (Ecto-ADP-ribosyltransferase 3, NAD(P)(+)-arginine ADP-ribosyltransferase 3, Mono(ADP-ribosyl) Transferase 3, TMART) (MaxLight 490)

Gene Names
ART3; ARTC3
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ART3; Monoclonal Antibody; ART3 (Ecto-ADP-ribosyltransferase 3; NAD(P)(+)-arginine ADP-ribosyltransferase 3; Mono(ADP-ribosyl) Transferase 3; TMART) (MaxLight 490); anti-ART3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3A2
Specificity
Recognizes human ART3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-ART3 antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 2ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa29-138 from human ART3 (NP_001170) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LDMADNAFDDEYLKCTDRMEIKYVPQLLKEEKASHQQLDTVWENAKAKWAARKTQIFLPMNFKDNHGIALMAYISEAQEQTPFYHLFSEAVKMAGQSREDYIYGFQFKAF
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-ART3 antibody
References
1. Genome-Wide Expression of Azoospermia Testes Demonstrates a Specific Profile and Implicates ART3 in Genetic Susceptibility. Okada H, Tajima A, Shichiri K, Tanaka A, Tanaka K, Inoue I.PLoS Genet. 2008 Feb;4(2):e26.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
419
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
ecto-ADP-ribosyltransferase 3 isoform b
NCBI Official Synonym Full Names
ADP-ribosyltransferase 3
NCBI Official Symbol
ART3
NCBI Official Synonym Symbols
ARTC3
NCBI Protein Information
ecto-ADP-ribosyltransferase 3
UniProt Protein Name
Ecto-ADP-ribosyltransferase 3
UniProt Gene Name
ART3
UniProt Synonym Gene Names
TMART; ARTC3
UniProt Entry Name
NAR3_HUMAN

NCBI Description

This gene encodes an arginine-specific ADP-ribosyltransferase. The encoded protein catalyzes a reversible reaction which modifies proteins by the addition or removal of ADP-ribose to an arginine residue to regulate the function of the modified protein. An ADP-ribosyltransferase pseudogene is located on chromosome 11. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

ART3: an arginine-specific ADP-ribosyltransferase. The encoded protein catalyzes a reversible reaction which modifies proteins by the addition or removal of ADP-ribose to an arginine residue to regulate the function of the modified protein. An ADP-ribosyltransferase pseudogene is located on chromosome 11. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Protein type: Membrane protein, integral; Membrane protein, GPI anchor; EC 2.4.2.31; Transferase

Chromosomal Location of Human Ortholog: 4q21.1|4p15.1-p14

Cellular Component: integral to plasma membrane

Molecular Function: NAD(P)+-protein-arginine ADP-ribosyltransferase activity; NAD+ ADP-ribosyltransferase activity

Biological Process: protein amino acid ADP-ribosylation

Research Articles on ART3

Similar Products

Product Notes

The ART3 art3 (Catalog #AAA6199617) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ART3 (Ecto-ADP-ribosyltransferase 3, NAD(P)(+)-arginine ADP-ribosyltransferase 3, Mono(ADP-ribosyl) Transferase 3, TMART) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ART3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 2ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ART3 art3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ART3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.