Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.23kD).)

Mouse anti-Human, Mouse ARPC5 Monoclonal Antibody | anti-ARPC5 antibody

ARPC5 (Actin-related Protein 2/3 Complex Subunit 5, Arp2/3 Complex 16kD Subunit 2, p16-ARC, ARC16) (PE)

Gene Names
ARPC5; ARC16; p16-Arc; dJ127C7.3
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ARPC5; Monoclonal Antibody; ARPC5 (Actin-related Protein 2/3 Complex Subunit 5; Arp2/3 Complex 16kD Subunit 2; p16-ARC; ARC16) (PE); anti-ARPC5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D10
Specificity
Recognizes human ARPC5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
7266
Applicable Applications for anti-ARPC5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa3-94 from ARPC5 (NP_005708) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKA
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.23kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.23kD).)
Related Product Information for anti-ARPC5 antibody
This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p16 subunit, has yet to be determined.
Product Categories/Family for anti-ARPC5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens actin related protein 2/3 complex subunit 5 (ARPC5), transcript variant 1, mRNA
NCBI Official Synonym Full Names
actin related protein 2/3 complex subunit 5
NCBI Official Symbol
ARPC5
NCBI Official Synonym Symbols
ARC16; p16-Arc; dJ127C7.3
NCBI Protein Information
actin-related protein 2/3 complex subunit 5
UniProt Protein Name
Actin-related protein 2/3 complex subunit 5
UniProt Gene Name
ARPC5
UniProt Synonym Gene Names
ARC16; p16-ARC
UniProt Entry Name
ARPC5_HUMAN

NCBI Description

This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p16 subunit, has yet to be determined. Alternatively spliced transcript variants encoding different isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]

Uniprot Description

ARPC5: Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Belongs to the ARPC5 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Cytoskeletal

Chromosomal Location of Human Ortholog: 1q25.3

Cellular Component: Arp2/3 protein complex; focal adhesion; cell projection; cytoplasm; cytosol; actin cytoskeleton

Molecular Function: actin filament binding; protein binding; structural constituent of cytoskeleton

Biological Process: axon guidance; ephrin receptor signaling pathway; innate immune response; actin cytoskeleton organization and biogenesis; cell motility

Research Articles on ARPC5

Similar Products

Product Notes

The ARPC5 arpc5 (Catalog #AAA6156590) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ARPC5 (Actin-related Protein 2/3 Complex Subunit 5, Arp2/3 Complex 16kD Subunit 2, p16-ARC, ARC16) (PE) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ARPC5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARPC5 arpc5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARPC5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.