Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (59.11kD).)

Mouse ARPC2 Monoclonal Antibody | anti-ARPC2 antibody

ARPC2 (Actin Related Protein 2/3 Complex Subunit 2 34kD, ARC34, PRO2446, p34-Arc, PNAS-139, ARP2/3 Protein Compex Subunit 34) (HRP)

Gene Names
ARPC2; ARC34; PRO2446; p34-Arc; PNAS-139
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ARPC2; Monoclonal Antibody; ARPC2 (Actin Related Protein 2/3 Complex Subunit 2 34kD; ARC34; PRO2446; p34-Arc; PNAS-139; ARP2/3 Protein Compex Subunit 34) (HRP); anti-ARPC2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
5C8
Specificity
Recognizes human ARPC2. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
1147
Applicable Applications for anti-ARPC2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant protein corresponding to aa1-300 from ARPC2 (AAH00590) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (59.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (59.11kD).)

Western Blot (WB)

(ARPC2 monoclonal antibody Western Blot analysis of ARPC2 expression in HeLa)

Western Blot (WB) (ARPC2 monoclonal antibody Western Blot analysis of ARPC2 expression in HeLa)

Western Blot (WB)

(ARPC2 monoclonal antibody Western Blot analysis of ARPC2 expression in PC-12)

Western Blot (WB) (ARPC2 monoclonal antibody Western Blot analysis of ARPC2 expression in PC-12)

Western Blot (WB)

(ARPC2 monoclonal antibody Western Blot analysis of ARPC2 expression in Raw 264.7)

Western Blot (WB) (ARPC2 monoclonal antibody Western Blot analysis of ARPC2 expression in Raw 264.7)

Western Blot (WB)

(ARPC2 monoclonal antibody Western Blot analysis of ARPC2 expression in NIH/3T3.)

Western Blot (WB) (ARPC2 monoclonal antibody Western Blot analysis of ARPC2 expression in NIH/3T3.)
Related Product Information for anti-ARPC2 antibody
The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p34 subunit, has yet to be determined. Two alternatively spliced variants have been characterized to date. Additional alternatively spliced variants have been described but their full length nature has not been determined.
Product Categories/Family for anti-ARPC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens actin related protein 2/3 complex, subunit 2, 34kDa, mRNA
NCBI Official Synonym Full Names
actin related protein 2/3 complex subunit 2
NCBI Official Symbol
ARPC2
NCBI Official Synonym Symbols
ARC34; PRO2446; p34-Arc; PNAS-139
NCBI Protein Information
actin-related protein 2/3 complex subunit 2

NCBI Description

This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p34 subunit, has yet to be determined. Two alternatively spliced variants have been characterized to date. Additional alternatively spliced variants have been described but their full length nature has not been determined. [provided by RefSeq, Jul 2008]

Research Articles on ARPC2

Similar Products

Product Notes

The ARPC2 (Catalog #AAA6151284) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ARPC2 (Actin Related Protein 2/3 Complex Subunit 2 34kD, ARC34, PRO2446, p34-Arc, PNAS-139, ARP2/3 Protein Compex Subunit 34) (HRP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ARPC2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARPC2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARPC2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.