Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human ARNT2 Monoclonal Antibody | anti-ARNT2 antibody

ARNT2 (Aryl Hydrocarbon Receptor Nuclear Translocator 2, ARNT Protein 2, Class E Basic Helix-loop-helix Protein 1, bHLHe1, BHLHE1, KIAA0307) (PE)

Gene Names
ARNT2; WEDAS; bHLHe1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ARNT2; Monoclonal Antibody; ARNT2 (Aryl Hydrocarbon Receptor Nuclear Translocator 2; ARNT Protein 2; Class E Basic Helix-loop-helix Protein 1; bHLHe1; BHLHE1; KIAA0307) (PE); anti-ARNT2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1B2
Specificity
Recognizes human ARNT2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
6523
Applicable Applications for anti-ARNT2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa464-563 from ARNT2 (NP_055677) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VPVPNLPAGVHEAGKSVEKADAIFSQERDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSSVVHVPGVNDIQSSSSTGQNMSQI
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged ARNT2 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ARNT2 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-ARNT2 antibody
The aryl hydrocarbon (Ah) receptor is involved in the induction of several enzymes that participate in xenobiotic metabolism. The ligand-free, cytosolic form of the Ah receptor is complexed to heat shock protein 90. Binding of ligand, which includes dioxin and polycyclic aromatic hydrocarbons, results in translocation of the ligand-binding subunit only to the nucleus. Induction of enzymes involved in xenobiotic metabolism occurs through binding of the ligand-bound Ah receptor to xenobiotic responsive elements in the promoters of genes for these enzymes. This gene encodes a protein that forms a complex with the ligand-bound Ah receptor, and is required for receptor function. The encoded protein has also been identified as the beta subunit of a heterodimeric transcription factor, hypoxia-inducible factor 1 (HIF1). A t(1;12)(q21;p13) translocation, which results in a TEL-ARNT fusion protein, is associated with leukemia. Sumoylation of ARNT modulates the ability of ARNT to interact with cooperative molecules such as PML, thereby regulating the transcriptional role of ARNT. This exemplifies a crucial role of protein sumoylation in modulating protein-protein interactions.
Product Categories/Family for anti-ARNT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens aryl hydrocarbon receptor nuclear translocator 2 (ARNT2), mRNA
NCBI Official Synonym Full Names
aryl hydrocarbon receptor nuclear translocator 2
NCBI Official Symbol
ARNT2
NCBI Official Synonym Symbols
WEDAS; bHLHe1
NCBI Protein Information
aryl hydrocarbon receptor nuclear translocator 2
UniProt Protein Name
Aryl hydrocarbon receptor nuclear translocator 2
UniProt Gene Name
ARNT2
UniProt Synonym Gene Names
BHLHE1; KIAA0307; ARNT protein 2; bHLHe1
UniProt Entry Name
ARNT2_HUMAN

NCBI Description

This gene encodes a member of the basic-helix-loop-helix-Per-Arnt-Sim (bHLH-PAS) superfamily of transcription factors. The encoded protein acts as a partner for several sensor proteins of the bHLH-PAS family, forming heterodimers with the sensor proteins that bind regulatory DNA sequences in genes responsive to developmental and environmental stimuli. Under hypoxic conditions, the encoded protein complexes with hypoxia-inducible factor 1alpha in the nucleus and this complex binds to hypoxia-responsive elements in enhancers and promoters of oxygen-responsive genes. A highly similar protein in mouse forms functional complexes with both aryl hydrocarbon receptors and Single-minded proteins, suggesting additional roles for the encoded protein in the metabolism of xenobiotic compounds and the regulation of neurogenesis, respectively. [provided by RefSeq, Dec 2013]

Uniprot Description

ARNT2: Specifically recognizes the xenobiotic response element (XRE). 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; DNA-binding; Apoptosis

Chromosomal Location of Human Ortholog: 15q24

Cellular Component: transcription factor complex; cytoplasm; nucleus

Molecular Function: signal transducer activity; DNA binding; aryl hydrocarbon receptor binding; protein heterodimerization activity; transcription factor activity

Biological Process: central nervous system development; regulation of transcription, DNA-dependent; transcription, DNA-dependent; in utero embryonic development; positive regulation of transcription, DNA-dependent; positive regulation of cell proliferation; response to hypoxia; positive regulation of transcription from RNA polymerase II promoter; brain development; signal transduction; response to estradiol stimulus; negative regulation of apoptosis

Disease: Webb-dattani Syndrome

Research Articles on ARNT2

Similar Products

Product Notes

The ARNT2 arnt2 (Catalog #AAA6156586) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ARNT2 (Aryl Hydrocarbon Receptor Nuclear Translocator 2, ARNT Protein 2, Class E Basic Helix-loop-helix Protein 1, bHLHe1, BHLHE1, KIAA0307) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARNT2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARNT2 arnt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARNT2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.