Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.22kD).)

Mouse anti-Human ARFIP1 Monoclonal Antibody | anti-ARFIP1 antibody

ARFIP1 (Arfaptin-1, ADP-ribosylation Factor-interacting Protein 1) (Biotin)

Gene Names
ARFIP1; HSU52521
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ARFIP1; Monoclonal Antibody; ARFIP1 (Arfaptin-1; ADP-ribosylation Factor-interacting Protein 1) (Biotin); anti-ARFIP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F10
Specificity
Recognizes human ARFIP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ARFIP1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-102 from human ARFIP1 (NP_055262) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGLSETQITSHGFDNTKEGVIEAGAFQGSPAPPLPSVMSPSRVAASRLAQQGSDLIVPAGGQRTQTKSGPVILADEIKNPAMEKLELVRKWSLNTYKCTRQIISEKLGRGSRTVDLELEAQIDILRDNKKKYENILKLAQTLSTQLFQMVHTQRQLGDAFADLSLKSLELHEEFGYNADTQKLLAKNGETLLGAINFFIASVNTLVNKTIEDTLMTVKQYESARIEYDAYRTDLEELNLGPRDANTLPKIEQSQHLFQAHKEKYDKMRNDVSVKLKFLEENKVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLKQFHIKLKTPGVDAPSWLEEQ
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.22kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.22kD).)

Western Blot (WB)

(Western Blot analysis of ARFIP1 expression in transfected 293T cell line by ARFIP1 monoclonal antibody. Lane 1: ARFIP1 transfected lysate (41.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ARFIP1 expression in transfected 293T cell line by ARFIP1 monoclonal antibody. Lane 1: ARFIP1 transfected lysate (41.7kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ARFIP1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ARFIP1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged ARFIP1 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ARFIP1 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-ARFIP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41.0 kDa (364aa) confirmed by MALDI-TOF
NCBI Official Full Name
arfaptin-1 isoform 2
NCBI Official Synonym Full Names
ADP ribosylation factor interacting protein 1
NCBI Official Symbol
ARFIP1
NCBI Official Synonym Symbols
HSU52521
NCBI Protein Information
arfaptin-1
UniProt Protein Name
Arfaptin-1
Protein Family
UniProt Gene Name
ARFIP1
UniProt Entry Name
ARFP1_HUMAN

Uniprot Description

ARFIP1: Putative target protein of ADP-ribosylation factor. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: G protein regulator, misc.

Chromosomal Location of Human Ortholog: 4q31.3

Cellular Component: Golgi membrane; trans-Golgi network membrane; cytosol

Molecular Function: protein domain specific binding

Biological Process: intracellular protein transport; regulation of protein secretion

Research Articles on ARFIP1

Similar Products

Product Notes

The ARFIP1 arfip1 (Catalog #AAA6140648) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ARFIP1 (Arfaptin-1, ADP-ribosylation Factor-interacting Protein 1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARFIP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARFIP1 arfip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARFIP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.