Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ARAF Monoclonal Antibody | anti-ARAF antibody

ARAF (V-raf Murine Sarcoma 3611 Viral Oncogene Homolog, OTTHUMP00000023212, Oncogene ARAF1, Ras-binding Protein DA-Raf, V-raf Murine Sarcoma 3611 Viral Oncogene Homolog 1, A-RAF, ARAF1, PKS2, RAFA1) (MaxLight 750)

Gene Names
ARAF; PKS2; A-RAF; ARAF1; RAFA1
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
ARAF; Monoclonal Antibody; ARAF (V-raf Murine Sarcoma 3611 Viral Oncogene Homolog; OTTHUMP00000023212; Oncogene ARAF1; Ras-binding Protein DA-Raf; V-raf Murine Sarcoma 3611 Viral Oncogene Homolog 1; A-RAF; ARAF1; PKS2; RAFA1) (MaxLight 750); anti-ARAF antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G2
Specificity
Recognizes human ARAF.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-ARAF antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Recombinant protein corresponding to aa151-250 from human ARAF with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RQQFYHSVQDLSGGSRQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSNLIQLTGQSFSTDAAGSRGGS
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ARAF antibody
Involved in the transduction of mitogenic signals from the cell membrane to the nucleus. May also regulate the TOR signaling cascade.
Product Categories/Family for anti-ARAF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
369
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
serine/threonine-protein kinase A-Raf isoform 1
NCBI Official Synonym Full Names
A-Raf proto-oncogene, serine/threonine kinase
NCBI Official Symbol
ARAF
NCBI Official Synonym Symbols
PKS2; A-RAF; ARAF1; RAFA1
NCBI Protein Information
serine/threonine-protein kinase A-Raf
UniProt Protein Name
Serine/threonine-protein kinase A-Raf
UniProt Gene Name
ARAF
UniProt Synonym Gene Names
ARAF1; PKS; PKS2
UniProt Entry Name
ARAF_HUMAN

NCBI Description

This proto-oncogene belongs to the RAF subfamily of the Ser/Thr protein kinase family, and maybe involved in cell growth and development. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jan 2012]

Uniprot Description

ARAF: a tyrosine kinase-like kinase of the RAF family. Involved in the transduction of mitogenic signals from the cell membrane to the nucleus. May play a role in the postsynaptic responses of hippocampal neuron. Frequently mutated in thyroid cancers, skin melanomas and at lower frequency in a wide range of human cancers. An activating mutation, mimicking phosphorylation of the activation loop, is seen in 60% of malignant melanoma samples. Raf mutations are generally exclusive to Ras activating mutations. Activating mutations are also seen in ~10% of colorectal cancers, in lung cancers and gliomas, and at a lower rate in several other tumors. Inactivating mutations are also seen and may result in activation of c-Raf and Erk. Mutations in B-Raf, MEK1 and MEK2 also associated with cardiofaciocutaneous syndrome, displaying morphological, cardiac and mental defects. Approved Inhibitor: Nexavar/Sorafenib.

Protein type: Protein kinase, TKL; Protein kinase, Ser/Thr (non-receptor); Oncoprotein; Kinase, protein; EC 2.7.11.1; TKL group; RAF family

Chromosomal Location of Human Ortholog: Xp11.4-p11.2

Molecular Function: protein serine/threonine kinase activity; protein binding; metal ion binding; receptor signaling protein activity; ATP binding; protein kinase activity

Biological Process: regulation of proteasomal ubiquitin-dependent protein catabolic process; protein modification process; protein amino acid phosphorylation; positive regulation of peptidyl-serine phosphorylation; negative regulation of apoptosis; regulation of TOR signaling pathway

Research Articles on ARAF

Similar Products

Product Notes

The ARAF araf (Catalog #AAA6236774) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ARAF (V-raf Murine Sarcoma 3611 Viral Oncogene Homolog, OTTHUMP00000023212, Oncogene ARAF1, Ras-binding Protein DA-Raf, V-raf Murine Sarcoma 3611 Viral Oncogene Homolog 1, A-RAF, ARAF1, PKS2, RAFA1) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARAF can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARAF araf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARAF, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.