Mouse anti-Human APOM Monoclonal Antibody | anti-APOM antibody

APOM (Apolipoprotein M, Apo-M, ApoM, Protein G3a, G3A, NG20, HSPC336) (HRP)

Cat. Num. AAA6151246

• Gene Names: APOM; G3a; NG20; apo-M; HSPC336
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: APOM; Monoclonal Antibody; APOM (Apolipoprotein M; Apo-M; ApoM; Protein G3a; G3A; NG20; HSPC336) (HRP); anti-APOM antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1
• Clone Number: 1F10
• Specificity: Recognizes human APOM.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-APOM antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Recombinant corresponding to aa23-189 from APOM (AAH20683) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (44.37kD).)

Western Blot (WB)

(Western Blot analysis of APOM expression in transfected 293T cell line by APOM monoclonal antibody. Lane 1: APOM transfected lysate (21.3kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged APOM is ~0.3ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of APOM over-expressed 293 cell line, cotransfected with APOM Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with APOM monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-APOM antibody

APOM is an apolipoprotein and member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. This protein is secreted through the plasma membrane but remains membrane-bound, where it is involved in lipid transport.

Product Categories/Family for anti-APOM antibody

Antibodies; Lipoproteins

NCBI and Uniprot Product Information

• NCBI GI #: 18089091
• NCBI GeneID: 55937
• Molecular Weight: 13,051 Da
• NCBI Official Full Name: Homo sapiens apolipoprotein M, mRNA
• NCBI Official Synonym Full Names: apolipoprotein M
• NCBI Official Symbol: APOM
• NCBI Official Synonym Symbols: G3a; NG20; apo-M; HSPC336
• NCBI Protein Information: apolipoprotein M
• Protein Family: Apomucin

NCBI Description

The protein encoded by this gene is an apolipoprotein and member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. The encoded protein is secreted through the plasma membrane but remains membrane-bound, where it is involved in lipid transport. Alternate splicing results in both coding and non-coding variants of this gene. [provided by RefSeq, Jan 2012]