Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human AP2B1 Monoclonal Antibody | anti-AP2B1 antibody

AP2B1 (AP-2 Complex Subunit beta, AP105B, Adapter-related Protein Complex 2 beta Subunit, Adaptor Protein Complex AP-2 Subunit beta, Beta-2-adaptin, Beta-adaptin, Clathrin Assembly Protein Complex 2 beta Large Chain, Plasma Membrane Adaptor HA2/AP2 Adapti

Gene Names
AP2B1; ADTB2; AP105B; CLAPB1; AP2-BETA
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AP2B1; Monoclonal Antibody; AP2B1 (AP-2 Complex Subunit beta; AP105B; Adapter-related Protein Complex 2 beta Subunit; Adaptor Protein Complex AP-2 Subunit beta; Beta-2-adaptin; Beta-adaptin; Clathrin Assembly Protein Complex 2 beta Large Chain; Plasma Membrane Adaptor HA2/AP2 Adapti; anti-AP2B1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D5
Specificity
Recognizes human AP2B1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Sequence Length
937
Applicable Applications for anti-AP2B1 antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa585-651 from human AP2B1 (NP_001273.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMG
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-AP2B1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
163
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
AP-2 complex subunit beta isoform b
NCBI Official Synonym Full Names
adaptor related protein complex 2 subunit beta 1
NCBI Official Symbol
AP2B1
NCBI Official Synonym Symbols
ADTB2; AP105B; CLAPB1; AP2-BETA
NCBI Protein Information
AP-2 complex subunit beta
UniProt Protein Name
AP-2 complex subunit beta
Protein Family
UniProt Gene Name
AP2B1
UniProt Synonym Gene Names
ADTB2; CLAPB1
UniProt Entry Name
AP2B1_HUMAN

NCBI Description

The protein encoded by this gene is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. The encoded protein is found on the cytoplasmic face of coated vesicles in the plasma membrane. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

AP2B1: Component of the adaptor protein complex 2 (AP-2). Adaptor protein complexes function in protein transport via transport vesicles in different membrane traffic pathways. Adaptor protein complexes are vesicle coat components and appear to be involved in cargo selection and vesicle formation. AP-2 is involved in clathrin-dependent endocytosis in which cargo proteins are incorporated into vesicles surrounded by clathrin (clathrin- coated vesicles, CCVs) which are destined for fusion with the early endosome. The clathrin lattice serves as a mechanical scaffold but is itself unable to bind directly to membrane components. Clathrin-associated adaptor protein (AP) complexes which can bind directly to both the clathrin lattice and to the lipid and protein components of membranes are considered to be the major clathrin adaptors contributing the CCV formation. AP-2 also serves as a cargo receptor to selectively sort the membrane proteins involved in receptor-mediated endocytosis. AP-2 seems to play a role in the recycling of synaptic vesicle membranes from the presynaptic surface. AP-2 recognizes Y-X-X-[FILMV] (Y-X-X-Phi) and [ED]-X-X-X-L-[LI] endocytosis signal motifs within the cytosolic tails of transmembrane cargo molecules. AP-2 may also play a role in maintaining normal post-endocytic trafficking through the ARF6-regulated, non-clathrin pathway. The AP-2 beta subunit acts via its C-terminal appendage domain as a scaffolding platform for endocytic accessory proteins; at least some clathrin- associated sorting proteins (CLASPs) are recognized by their [DE]- X(1,2)-F-X-X-[FL]-X-X-X-R motif. The AP-2 beta subunit binds to clathrin heavy chain, promoting clathrin lattice assembly; clathrin displaces at least some CLASPs from AP2B1 which probably then can be positioned for further coat assembly. Belongs to the adaptor complexes large subunit family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: intracellular membrane-bound organelle; membrane; plasma membrane; AP-2 adaptor complex; cytosol

Molecular Function: clathrin binding; protein binding; signal sequence binding; protein transporter activity

Biological Process: epidermal growth factor receptor signaling pathway; negative regulation of epidermal growth factor receptor signaling pathway; synaptic transmission; intracellular protein transport; axon guidance; nerve growth factor receptor signaling pathway; viral reproduction; ephrin receptor signaling pathway; antigen processing and presentation of exogenous peptide antigen via MHC class II; regulation of defense response to virus by virus

Research Articles on AP2B1

Similar Products

Product Notes

The AP2B1 ap2b1 (Catalog #AAA6231574) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AP2B1 (AP-2 Complex Subunit beta, AP105B, Adapter-related Protein Complex 2 beta Subunit, Adaptor Protein Complex AP-2 Subunit beta, Beta-2-adaptin, Beta-adaptin, Clathrin Assembly Protein Complex 2 beta Large Chain, Plasma Membrane Adaptor HA2/AP2 Adapti reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AP2B1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AP2B1 ap2b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AP2B1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.