Mouse anti-Human Antithrombin-III Monoclonal Antibody | anti-ATIII antibody
Antithrombin-III (SERPINC1, ATIII, Serpin C1, AT3, PRO0309) (HRP)
ATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFG
DKSLTFNDLYVSDAFHKAFLEVNEEGSEAAASTAVVIAGRSLNPNRVTFKANRPFLVFIREVPLNTIIFMGRVANPCVK
Western Blot (WB)
(Western Blot analysis of MBS6151214 expression in transfected 293T cell line by MBS6151214 Lane 1: SERPINC1 transfected lysate (29.1kD). Lane 2: Non-transfected lysate.)
NCBI and Uniprot Product Information
NCBI Description
The protein encoded by this gene is a plasma protease inhibitor and a member of the serpin superfamily. This protein inhibits thrombin as well as other activated serine proteases of the coagulation system, and it regulates the blood coagulation cascade. The protein includes two functional domains: the heparin binding-domain at the N-terminus of the mature protein, and the reactive site domain at the C-terminus. The inhibitory activity is enhanced by the presence of heparin. More than 120 mutations have been identified for this gene, many of which are known to cause antithrombin-III deficiency. [provided by RefSeq, Jul 2009]
Research Articles on ATIII
Similar Products
Product Notes
The ATIII (Catalog #AAA6151214) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Antithrombin-III (SERPINC1, ATIII, Serpin C1, AT3, PRO0309) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Antithrombin-III can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATIII for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MYSNVIGTVT SGKRKVYLLS LLLIGFWDCV TCHGSPVDIC TAEPRDIPMN PMCIYRSPEK KATEDEGSEQ KIPEATNRRV WELSKANSRF ATTFYQ HLADSKNDND NIFLSPLSIS TAFAMTKLGA CNDTLQQLME VFKFDTISEK TSDQIHFFFA KLNCRLYRKA NKSSKLVSAN RLFG DK SLTFNDLYVS DAFHKAFLEV NEEGSEAAAS TAVVIAGRSL NPNRVTFKAN RPFLVFIREV PLNTIIFMGR VANPCVK. It is sometimes possible for the material contained within the vial of "Antithrombin-III, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.