Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to ANGPTL7 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml])

Mouse ANGPTL7 Monoclonal Antibody | anti-ANGPTL7 antibody

ANGPTL7 (Angiopoietin-like 7, AngX, CDT6, RP4-647M16.2, dJ647M16.1) (HRP)

Gene Names
ANGPTL7; AngX; CDT6; dJ647M16.1
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
ANGPTL7; Monoclonal Antibody; ANGPTL7 (Angiopoietin-like 7; AngX; CDT6; RP4-647M16.2; dJ647M16.1) (HRP); Angiopoietin-like 7; dJ647M16.1; anti-ANGPTL7 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
30000000
Specificity
Recognizes ANGPTL7.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-ANGPTL7 antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ANGPTL7 (NP_066969, 27aa-126aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSAD
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to ANGPTL7 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to ANGPTL7 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ANGPTL7 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ANGPTL7 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml])
Product Categories/Family for anti-ANGPTL7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
angiopoietin-related protein 7
NCBI Official Synonym Full Names
angiopoietin like 7
NCBI Official Symbol
ANGPTL7
NCBI Official Synonym Symbols
AngX; CDT6; dJ647M16.1
NCBI Protein Information
angiopoietin-related protein 7
UniProt Protein Name
Angiopoietin-related protein 7
UniProt Gene Name
ANGPTL7
UniProt Synonym Gene Names
CDT6
UniProt Entry Name
ANGL7_HUMAN

Uniprot Description

ANGPTL7:

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 1p36

Cellular Component: extracellular region

Biological Process: response to oxidative stress

Research Articles on ANGPTL7

Similar Products

Product Notes

The ANGPTL7 angptl7 (Catalog #AAA6183258) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ANGPTL7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ANGPTL7 angptl7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ANGPTL7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.