Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human Androgen Receptor Monoclonal Antibody | anti-AR antibody

Androgen Receptor (Dihydrotestosterone Receptor, Nuclear Receptor Subfamily 3 Group C Member 4, AR, DHTR, NR3C4) (HRP)

Gene Names
AR; KD; AIS; TFM; DHTR; SBMA; HYSP1; NR3C4; SMAX1; HUMARA
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Androgen Receptor; Monoclonal Antibody; Androgen Receptor (Dihydrotestosterone Receptor; Nuclear Receptor Subfamily 3 Group C Member 4; AR; DHTR; NR3C4) (HRP); anti-AR antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1G3
Specificity
Recognizes human AR.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-AR antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa221-320 from human AR (NP_000035) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(AR monoclonal antibody Western Blot analysis of AR expression in Hela NE.)

Western Blot (WB) (AR monoclonal antibody Western Blot analysis of AR expression in Hela NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to AR on formalin-fixed paraffin-embedded human renal cell carcinoma tissue. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to AR on formalin-fixed paraffin-embedded human renal cell carcinoma tissue. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged AR is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged AR is ~0.1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between KLK3 and AR HeLa cells were stained with KLK3 rabbit purified polyclonal 1:1200 and AR mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between KLK3 and AR HeLa cells were stained with KLK3 rabbit purified polyclonal 1:1200 and AR mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Product Categories/Family for anti-AR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
367
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,643 Da
NCBI Official Full Name
androgen receptor isoform 1
NCBI Official Synonym Full Names
androgen receptor
NCBI Official Symbol
AR
NCBI Official Synonym Symbols
KD; AIS; TFM; DHTR; SBMA; HYSP1; NR3C4; SMAX1; HUMARA
NCBI Protein Information
androgen receptor; androgen nuclear receptor variant 2; dihydrotestosterone receptor; nuclear receptor subfamily 3 group C member 4
UniProt Protein Name
Androgen receptor
Protein Family
UniProt Gene Name
AR
UniProt Synonym Gene Names
DHTR; NR3C4
UniProt Entry Name
ANDR_HUMAN

Uniprot Description

AR: a nuclear hormone receptor and transcription factor. Regulates gene expression and affects cellular proliferation and differentiation in target tissues. Two splice-variant isoforms have been described.

Protein type: Nuclear receptor; DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: Xq12

Cellular Component: nucleoplasm; protein complex; nuclear chromatin; cytoplasm; nucleus

Molecular Function: protein dimerization activity; ligand-dependent nuclear receptor activity; zinc ion binding; androgen binding; beta-catenin binding; transcription factor binding; protein binding; androgen receptor activity; enzyme binding; DNA binding; chromatin binding; transcription factor activity; receptor binding

Biological Process: prostate gland development; transcription initiation from RNA polymerase II promoter; intracellular receptor-mediated signaling pathway; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; signal transduction; protein oligomerization; activation of NF-kappaB transcription factor; negative regulation of integrin biosynthetic process; cell proliferation; cell-cell signaling; transport; positive regulation of cell proliferation; androgen receptor signaling pathway; positive regulation of transcription from RNA polymerase III promoter; gene expression; positive regulation of transcription from RNA polymerase II promoter; steroid hormone mediated signaling; positive regulation of integrin biosynthetic process; cell growth; sex differentiation; positive regulation of phosphorylation

Disease: Androgen Insensitivity Syndrome; Prostate Cancer; Androgen Insensitivity, Partial; Hypospadias 1, X-linked; Spinal And Bulbar Muscular Atrophy, X-linked 1

Similar Products

Product Notes

The AR ar (Catalog #AAA6151200) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Androgen Receptor (Dihydrotestosterone Receptor, Nuclear Receptor Subfamily 3 Group C Member 4, AR, DHTR, NR3C4) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Androgen Receptor can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AR ar for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Androgen Receptor, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.