Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of AMPD2 expression in transfected 293T cell line by AMPD2 monoclonal antibody (M05), clone 3C5.Lane 1: AMPD2 transfected lysate (92.1 KDa).Lane 2: Non-transfected lysate.)

Mouse AMPD2 Monoclonal Antibody | anti-AMPD2 antibody

AMPD2 (Adenosine Monophosphate Deaminase 2 (isoform L)) (Biotin)

Gene Names
AMPD2; PCH9; SPG63
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
AMPD2; Monoclonal Antibody; AMPD2 (Adenosine Monophosphate Deaminase 2 (isoform L)) (Biotin); Adenosine Monophosphate Deaminase 2 (isoform L); anti-AMPD2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C5
Specificity
Recognizes AMPD2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-AMPD2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
AMPD2 (NP_631895, 86aa-185aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of AMPD2 expression in transfected 293T cell line by AMPD2 monoclonal antibody (M05), clone 3C5.Lane 1: AMPD2 transfected lysate (92.1 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AMPD2 expression in transfected 293T cell line by AMPD2 monoclonal antibody (M05), clone 3C5.Lane 1: AMPD2 transfected lysate (92.1 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-AMPD2 antibody
Adenosine monophosphate deaminase-2 (EC 3.5.4.6) catalyzes the deamination of AMP to IMP and plays an important role in the purine nucleotide cycle. [supplied by OMIM]
Product Categories/Family for anti-AMPD2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
271
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
92kDa
NCBI Official Full Name
AMP deaminase 2 isoform 2
NCBI Official Synonym Full Names
adenosine monophosphate deaminase 2
NCBI Official Symbol
AMPD2
NCBI Official Synonym Symbols
PCH9; SPG63
NCBI Protein Information
AMP deaminase 2
UniProt Protein Name
AMP deaminase 2
Protein Family
UniProt Gene Name
AMPD2
UniProt Entry Name
AMPD2_HUMAN

NCBI Description

The protein encoded by this gene is important in purine metabolism by converting AMP to IMP. The encoded protein, which acts as a homotetramer, is one of three AMP deaminases found in mammals. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]

Uniprot Description

AMPD2: AMP deaminase plays a critical role in energy metabolism. Belongs to the adenosine and AMP deaminases family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.5.4.6; Hydrolase; Nucleotide Metabolism - purine

Chromosomal Location of Human Ortholog: 1p13.3

Cellular Component: cytosol

Molecular Function: metal ion binding; AMP deaminase activity

Biological Process: IMP biosynthetic process; IMP salvage; nucleobase, nucleoside and nucleotide metabolic process; purine base metabolic process; purine salvage

Disease: Spastic Paraplegia 63, Autosomal Recessive; Pontocerebellar Hypoplasia, Type 9

Research Articles on AMPD2

Similar Products

Product Notes

The AMPD2 ampd2 (Catalog #AAA6172722) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's AMPD2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AMPD2 ampd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AMPD2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.