Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of AMELX expression in transfected 293T cell line by AMELX monoclonal antibody (M04), clone 6G3.Lane 1: AMELX transfected lysate (21.603 KDa).Lane 2: Non-transfected lysate.)

Mouse AMELX Monoclonal Antibody | anti-AMELX antibody

AMELX (Amelogenin (Amelogenesis Imperfecta 1, X-Linked), AIH1, ALGN, AMG, AMGL, AMGX) (PE)

Gene Names
AMELX; AMG; AI1E; AIH1; ALGN; AMGL; AMGX
Applications
Western Blot
Purity
Purified
Synonyms
AMELX; Monoclonal Antibody; AMELX (Amelogenin (Amelogenesis Imperfecta 1; X-Linked); AIH1; ALGN; AMG; AMGL; AMGX) (PE); Amelogenin (Amelogenesis Imperfecta 1; AMGX; anti-AMELX antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
6G3
Specificity
Recognizes AMELX.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-AMELX antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
AMELX (NP_001133, 93aa-191aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of AMELX expression in transfected 293T cell line by AMELX monoclonal antibody (M04), clone 6G3.Lane 1: AMELX transfected lysate (21.603 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AMELX expression in transfected 293T cell line by AMELX monoclonal antibody (M04), clone 6G3.Lane 1: AMELX transfected lysate (21.603 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged AMELX is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged AMELX is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-AMELX antibody
This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in this gene cause X-linked amelogenesis imperfecta. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]
Product Categories/Family for anti-AMELX antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
265
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
amelogenin, X isoform isoform 1
NCBI Official Synonym Full Names
amelogenin, X-linked
NCBI Official Symbol
AMELX
NCBI Official Synonym Symbols
AMG; AI1E; AIH1; ALGN; AMGL; AMGX
NCBI Protein Information
amelogenin, X isoform
UniProt Protein Name
Amelogenin, X isoform
Protein Family
UniProt Gene Name
AMELX
UniProt Synonym Gene Names
AMG; AMGX
UniProt Entry Name
AMELX_HUMAN

NCBI Description

This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in this gene cause X-linked amelogenesis imperfecta. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

AMELX: Plays a role in biomineralization. Seems to regulate the formation of crystallites during the secretory stage of tooth enamel development. Thought to play a major role in the structural organization and mineralization of developing enamel. Defects in AMELX are the cause of amelogenesis imperfecta type 1E (AI1E). A X-linked defect of dental enamel formation. Teeth have only a thin layer of enamel with normal hardness. The thinness of the enamel makes the teeth appear small. Belongs to the amelogenin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: Xp22.31-p22.1

Cellular Component: proteinaceous extracellular matrix; cell surface

Molecular Function: identical protein binding; protein binding; growth factor activity; hydroxyapatite binding; structural constituent of tooth enamel

Biological Process: osteoblast differentiation; cell proliferation; ion homeostasis; biomineral formation; positive regulation of collagen biosynthetic process; chondrocyte differentiation; epithelial to mesenchymal transition; signal transduction; cell adhesion; odontogenesis of dentine-containing teeth

Disease: Amelogenesis Imperfecta, Type Ie

Research Articles on AMELX

Similar Products

Product Notes

The AMELX amelx (Catalog #AAA6184522) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's AMELX can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AMELX amelx for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AMELX, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.