Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human ALOX15B Monoclonal Antibody | anti-ALOX15B antibody

ALOX15B (Arachidonate 15-lipoxygenase B, 15-LOX-B, 15-lipoxygenase 2, 15-LOX-2, Arachidonate 15-lipoxygenase type II)

Gene Names
ALOX15B; 15-LOX-2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ALOX15B; Monoclonal Antibody; ALOX15B (Arachidonate 15-lipoxygenase B; 15-LOX-B; 15-lipoxygenase 2; 15-LOX-2; Arachidonate 15-lipoxygenase type II); Anti -ALOX15B (Arachidonate 15-lipoxygenase B; anti-ALOX15B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A7
Specificity
Recognizes human ALOX15B.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
NANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQA
Applicable Applications for anti-ALOX15B antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa181-280 from human ALOX15B (AAH35217) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Testing Data

(Detection limit for recombinant GST tagged ALOX15B is ~10ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ALOX15B is ~10ng/ml as a capture antibody.)
Related Product Information for anti-ALOX15B antibody
Converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while linoleic acid is less well metabolized.
Product Categories/Family for anti-ALOX15B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
247
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75,857 Da
NCBI Official Full Name
arachidonate 15-lipoxygenase B isoform b
NCBI Official Synonym Full Names
arachidonate 15-lipoxygenase, type B
NCBI Official Symbol
ALOX15B
NCBI Official Synonym Symbols
15-LOX-2
NCBI Protein Information
arachidonate 15-lipoxygenase B; 15-LOX-B; 15S-lipoxygenase; arachidonate 15-lipoxygenase 2; arachidonate omega(6) lipoxygenase; arachidonate 15-lipoxygenase type II; arachidonate 15-lipoxygenase, second type
UniProt Protein Name
Arachidonate 15-lipoxygenase B
UniProt Gene Name
ALOX15B
UniProt Synonym Gene Names
15-LOX-B; 15-LOX-2
UniProt Entry Name
LX15B_HUMAN

NCBI Description

This gene encodes a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The encoded protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively. This gene is located in a cluster of related genes and a pseudogene that spans approximately 100 kilobases on the short arm of chromosome 17. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

ALOX15B: Converts arachidonic acid exclusively to 15S- hydroperoxyeicosatetraenoic acid, while linoleic acid is less well metabolized. Belongs to the lipoxygenase family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.13.11.33; Apoptosis; Cell cycle regulation; Oxidoreductase; Lipid Metabolism - arachidonic acid; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: extrinsic to membrane; cytoskeleton; membrane; cytoplasm; plasma membrane; intracellular; cytosol; nucleus

Molecular Function: arachidonate 15-lipoxygenase activity; lipoxygenase activity; iron ion binding; calcium ion binding; lipid binding

Biological Process: prostate gland development; negative regulation of cell proliferation; lipoxygenase pathway; apoptosis; regulation of epithelial cell differentiation; arachidonic acid metabolic process; linoleic acid metabolic process; hepoxilin biosynthetic process; lipid metabolic process; negative regulation of cell migration; positive regulation of keratinocyte differentiation; negative regulation of growth; negative regulation of cell cycle

Research Articles on ALOX15B

Similar Products

Product Notes

The ALOX15B alox15b (Catalog #AAA6000358) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ALOX15B (Arachidonate 15-lipoxygenase B, 15-LOX-B, 15-lipoxygenase 2, 15-LOX-2, Arachidonate 15-lipoxygenase type II) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ALOX15B can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the ALOX15B alox15b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NANFYLQAGS AFAEMKIKGL LDRKGLWRSL NEMKRIFNFR RTPAAEHAFE HWQEDAFFAS QFLNGLNPVL IRRCHYLPKN FPVTDAMVAS VLGPGTSLQA. It is sometimes possible for the material contained within the vial of "ALOX15B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.