Western Blot (WB)
(ALG6 monoclonal antibody, Western Blot analysis of ALG6 expression in Hela NE.)
Mouse anti-Human ALG6 Monoclonal Antibody | anti-ALG6 antibody
ALG6 (Dolichyl Pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase, Asparagine-linked Glycosylation Protein 6 Homolog, Dol-P-Glc:Man(9)GlcNAc(2)-PP-Dol alpha-1,3-glucosyltransferase, Dolichyl-P-Glc:Man9GlcNAc2-PP-dolichyl Glucosyltransferase, My046) (
Gene Names
ALG6; CDG1C
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ALG6; Monoclonal Antibody; ALG6 (Dolichyl Pyrophosphate Man9GlcNAc2 alpha-1; 3-glucosyltransferase; Asparagine-linked Glycosylation Protein 6 Homolog; Dol-P-Glc:Man(9)GlcNAc(2)-PP-Dol alpha-1; Dolichyl-P-Glc:Man9GlcNAc2-PP-dolichyl Glucosyltransferase; My046) (; anti-ALG6 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G11
Specificity
Recognizes human ALG6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-ALG6 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa25-115 from human ALG6 (NP_037471) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SYSGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRT*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(ALG6 monoclonal antibody, Western Blot analysis of ALG6 expression in Hela NE.)
Western Blot (WB)
(ALG6 monoclonal antibody, Western Blot analysis of ALG6 expression in Hela NE.)
Related Product Information for anti-ALG6 antibody
Adds the first glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation. Transfers glucose from dolichyl phosphate glucose (Dol-P-Glc) onto the lipid-linked oligosaccharide Man9GlcNAc(2)-PP-Dol.
Product Categories/Family for anti-ALG6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase
NCBI Official Synonym Full Names
ALG6 alpha-1,3-glucosyltransferase
NCBI Official Symbol
ALG6
NCBI Official Synonym Symbols
CDG1C
NCBI Protein Information
dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase
UniProt Protein Name
Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase
UniProt Gene Name
ALG6
UniProt Synonym Gene Names
My046
UniProt Entry Name
ALG6_HUMAN
NCBI Description
This gene encodes a member of the ALG6/ALG8 glucosyltransferase family. The encoded protein catalyzes the addition of the first glucose residue to the growing lipid-linked oligosaccharide precursor of N-linked glycosylation. Mutations in this gene are associated with congenital disorders of glycosylation type Ic. [provided by RefSeq, Jul 2008]
Research Articles on ALG6
Similar Products
Product Notes
The ALG6 alg6 (Catalog #AAA6129965) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ALG6 (Dolichyl Pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase, Asparagine-linked Glycosylation Protein 6 Homolog, Dol-P-Glc:Man(9)GlcNAc(2)-PP-Dol alpha-1,3-glucosyltransferase, Dolichyl-P-Glc:Man9GlcNAc2-PP-dolichyl Glucosyltransferase, My046) ( reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ALG6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ALG6 alg6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ALG6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
