Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.38kD).)

Mouse anti-Human, Rat ALG12 Monoclonal Antibody | anti-ALG12 antibody

ALG12 (Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase, Asparagine-linked Glycosylation Protein 12 Homolog, Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase, Mannosyltransferase ALG12 Homolog, Membrane Protein SB87,

Gene Names
ALG12; CDG1G; ECM39; hALG12; PP14673
Reactivity
Human, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ALG12; Monoclonal Antibody; ALG12 (Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1; 6-mannosyltransferase; Asparagine-linked Glycosylation Protein 12 Homolog; Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1; Mannosyltransferase ALG12 Homolog; Membrane Protein SB87; ; anti-ALG12 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5E3
Specificity
Recognizes human ALG12. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-ALG12 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa369-426 from human ALG12 (NP_077010) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NYPGGVAMQRLHQLVPPQTDVLLHIDVAAAQTGVSRFLQVNSAWRYDKREDVQPGTG
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.38kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.38kD).)

Western Blot (WB)

(ALG12 monoclonal antibody. Western Blot analysis of ALG12 expression in HeLa.)

Western Blot (WB) (ALG12 monoclonal antibody. Western Blot analysis of ALG12 expression in HeLa.)

Western Blot (WB)

(ALG12 monoclonal antibody. Western Blot analysis of ALG12 expression in PC-12.)

Western Blot (WB) (ALG12 monoclonal antibody. Western Blot analysis of ALG12 expression in PC-12.)

Testing Data

(Detection limit for recombinant GST tagged ALG12 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ALG12 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-ALG12 antibody
Adds the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor (dolichol-PP-Man7GlcNAc2) required for protein glycosylation.
Product Categories/Family for anti-ALG12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase
NCBI Official Synonym Full Names
ALG12 alpha-1,6-mannosyltransferase
NCBI Official Symbol
ALG12
NCBI Official Synonym Symbols
CDG1G; ECM39; hALG12; PP14673
NCBI Protein Information
dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase
UniProt Protein Name
Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase
UniProt Gene Name
ALG12
UniProt Synonym Gene Names
PP14673; hALG12
UniProt Entry Name
ALG12_HUMAN

NCBI Description

This gene encodes a member of the glycosyltransferase 22 family. The encoded protein catalyzes the addition of the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor (dolichol-PP-Man(7)GlcNAc(2)) required for protein glycosylation. Mutations in this gene have been associated with congenital disorder of glycosylation type Ig (CDG-Ig)characterized by abnormal N-glycosylation. [provided by RefSeq, Jul 2008]

Research Articles on ALG12

Similar Products

Product Notes

The ALG12 alg12 (Catalog #AAA6151176) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ALG12 (Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase, Asparagine-linked Glycosylation Protein 12 Homolog, Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase, Mannosyltransferase ALG12 Homolog, Membrane Protein SB87, reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ALG12 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ALG12 alg12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ALG12, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.