Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to ALDH4A1 on formalin-fixed paraffin-embedded human liver tissue.[antibody concentration 5ug/ml].)

Mouse anti-Human ALDH4A1 Monoclonal Antibody | anti-ALDH4A1 antibody

ALDH4A1 (Aldehyde Dehydrogenase Family 4 Member A1, Delta-1-pyrroline-5-carboxylate Dehydrogenase, Mitochondrial, P5C Dehydrogenase, ALDH4, P5CDH) (PE)

Gene Names
ALDH4A1; P5CD; ALDH4; P5CDh
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ALDH4A1; Monoclonal Antibody; ALDH4A1 (Aldehyde Dehydrogenase Family 4 Member A1; Delta-1-pyrroline-5-carboxylate Dehydrogenase; Mitochondrial; P5C Dehydrogenase; ALDH4; P5CDH) (PE); anti-ALDH4A1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A12-A5
Specificity
Recognizes human ALDH4A1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ALDH4A1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-564 from ALDH4A1 (AAH07581) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MLLPAPALRRALLSRPWTGAGLRWKHTSSLKVANEPVLAFTQGSPERDALQKALKDLKGRMEAIPCVVGDEEVWTSDVQYQVSPFNHGHKVAKFCYADKSLLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLP
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to ALDH4A1 on formalin-fixed paraffin-embedded human liver tissue.[antibody concentration 5ug/ml].)

Testing Data (Immunoperoxidase of monoclonal antibody to ALDH4A1 on formalin-fixed paraffin-embedded human liver tissue.[antibody concentration 5ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ALDH4A1 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ALDH4A1 is 0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of ALDH4A1 expression in transfected 293T cell line by ALDH4A1 monoclonal antibody Lane 1: ALDH4A1 transfected lysate (61.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ALDH4A1 expression in transfected 293T cell line by ALDH4A1 monoclonal antibody Lane 1: ALDH4A1 transfected lysate (61.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(ALDH4A1 monoclonal antibody Western Blot analysis of ALDH4A1 expression in A-431.)

Western Blot (WB) (ALDH4A1 monoclonal antibody Western Blot analysis of ALDH4A1 expression in A-431.)
Product Categories/Family for anti-ALDH4A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
56,043 Da
NCBI Official Full Name
Homo sapiens aldehyde dehydrogenase 4 family, member A1, mRNA
NCBI Official Synonym Full Names
aldehyde dehydrogenase 4 family member A1
NCBI Official Symbol
ALDH4A1
NCBI Official Synonym Symbols
P5CD; ALDH4; P5CDh
NCBI Protein Information
delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial

NCBI Description

This protein belongs to the aldehyde dehydrogenase family of proteins. This enzyme is a mitochondrial matrix NAD-dependent dehydrogenase which catalyzes the second step of the proline degradation pathway, converting pyrroline-5-carboxylate to glutamate. Deficiency of this enzyme is associated with type II hyperprolinemia, an autosomal recessive disorder characterized by accumulation of delta-1-pyrroline-5-carboxylate (P5C) and proline. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jun 2009]

Research Articles on ALDH4A1

Similar Products

Product Notes

The ALDH4A1 (Catalog #AAA6156473) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ALDH4A1 (Aldehyde Dehydrogenase Family 4 Member A1, Delta-1-pyrroline-5-carboxylate Dehydrogenase, Mitochondrial, P5C Dehydrogenase, ALDH4, P5CDH) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ALDH4A1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ALDH4A1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ALDH4A1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.