Mouse AKT3 Monoclonal Antibody | anti-AKT3 antibody

AKT3 (v-akt murine Thymoma Viral Oncogene Homolog 3 (Protein Kinase B, gamma), DKFZp434N0250, PKB-GAMMA, PKBG, PRKBG, RAC-PK-gamma, RAC-gamma, STK-2) (HRP)

Cat. Num. AAA6179484

• Gene Names: AKT3; MPPH; PKBG; MPPH2; PRKBG; STK-2; PKB-GAMMA; RAC-gamma; RAC-PK-gamma
• Applications: Western Blot
• Purity: Purified
• Synonyms: AKT3; Monoclonal Antibody; AKT3 (v-akt murine Thymoma Viral Oncogene Homolog 3 (Protein Kinase B; gamma); DKFZp434N0250; PKB-GAMMA; PKBG; PRKBG; RAC-PK-gamma; RAC-gamma; STK-2) (HRP); v-akt murine Thymoma Viral Oncogene Homolog 3 (Protein Kinase B; STK-2; anti-AKT3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6F12
• Specificity: Recognizes AKT3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 479

• Applicable Applications for anti-AKT3 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: AKT3 (AAD29089, 100aa-189aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDE
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(AKT3 monoclonal antibody (M07), clone 6F12 Western Blot analysis of AKT3 expression in HeLa (Cat # L013V1).)

Western Blot (WB)

(AKT3 monoclonal antibody (M07), clone 6F12. Western Blot analysis of AKT3 expression in MCF-7 (Cat # L046V1).)

Western Blot (WB)

(AKT3 monoclonal antibody (M07), clone 6F12. Western Blot analysis of AKT3 expression in NIH/3T3 (Cat # L018V1).)

Testing Data

(Detection limit for recombinant GST tagged AKT3 is approximately 0.1ng/ml as a capture antibody.)

Western Blot (WB)

(AKT3 monoclonal antibody (M07), clone 6F12. Western Blot analysis of AKT3 expression in Raw 264.7 (Cat # L024V1).)

Product Categories/Family for anti-AKT3 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 4757579
• NCBI GeneID: 10000
• NCBI Official Full Name: protein kinase B gamma
• NCBI Official Synonym Full Names: AKT serine/threonine kinase 3
• NCBI Official Symbol: AKT3
• NCBI Official Synonym Symbols: MPPH; PKBG; MPPH2; PRKBG; STK-2; PKB-GAMMA; RAC-gamma; RAC-PK-gamma
• NCBI Protein Information: RAC-gamma serine/threonine-protein kinase
• Protein Family: RAC-gamma serine/threonine-protein kinase

NCBI Description

The protein encoded by this gene is a member of the AKT, also called PKB, serine/threonine protein kinase family. AKT kinases are known to be regulators of cell signaling in response to insulin and growth factors. They are involved in a wide variety of biological processes including cell proliferation, differentiation, apoptosis, tumorigenesis, as well as glycogen synthesis and glucose uptake. This kinase has been shown to be stimulated by platelet-derived growth factor (PDGF), insulin, and insulin-like growth factor 1 (IGF1). Alternatively splice transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008]