Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse AKAP4 Monoclonal Antibody | anti-AKAP4 antibody

AKAP4 (A Kinase (PRKA) Anchor Protein 4, AKAP82, FSC1, HI, hAKAP82, p82) (MaxLight 650)

Gene Names
AKAP4; HI; p82; CT99; FSC1; PRKA4; AKAP-4; AKAP82; AKAP 82; hAKAP82
Applications
Western Blot
Purity
Purified
Synonyms
AKAP4; Monoclonal Antibody; AKAP4 (A Kinase (PRKA) Anchor Protein 4; AKAP82; FSC1; HI; hAKAP82; p82) (MaxLight 650); A Kinase (PRKA) Anchor Protein 4; p82; anti-AKAP4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
4G1
Specificity
Recognizes AKAP4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-AKAP4 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
AKAP4 (NP_003877, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MMAYSDTTMMSDDIDWLRSHRGVCKVDLYNPEGQQDQDRKVICFVDVSTLNVEDKDYKDAASSSSEGNLNLGSLEEKEIIVIKDTEKKDQSKTEGSVCLF
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-AKAP4 antibody
The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is localized to the sperm flagellum and may be involved in the regulation of sperm motility. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq]
Product Categories/Family for anti-AKAP4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 94 kDa

Observed: 100 kDa
NCBI Official Full Name
A-kinase anchor protein 4 isoform 1
NCBI Official Synonym Full Names
A kinase (PRKA) anchor protein 4
NCBI Official Symbol
AKAP4
NCBI Official Synonym Symbols
HI; p82; CT99; FSC1; PRKA4; AKAP-4; AKAP82; AKAP 82; hAKAP82
NCBI Protein Information
A-kinase anchor protein 4; AKAP4; testis-specific gene HI; cancer/testis antigen 99; A-kinase anchor protein 82 kDa; major sperm fibrous sheath protein; protein kinase A anchoring protein 4; protein kinase A-anchoring protein 4
UniProt Protein Name
A-kinase anchor protein 4
Protein Family
UniProt Gene Name
AKAP4
UniProt Synonym Gene Names
AKAP-4; AKAP 82; hAKAP82; HI; PRKA4
UniProt Entry Name
AKAP4_HUMAN

NCBI Description

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is localized to the sperm flagellum and may be involved in the regulation of sperm motility. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

AKAP4: Major structural component of sperm fibrous sheath. Plays a role in sperm motility. Belongs to the AKAP110 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cancer Testis Antigen (CTA); Adaptor/scaffold

Chromosomal Location of Human Ortholog: Xp11.2

Cellular Component: cytoskeleton; perinuclear region of cytoplasm; cytoplasm; nucleus; Z disc; cAMP-dependent protein kinase complex

Molecular Function: protein kinase A binding

Biological Process: protein localization; sperm motility; cell projection organization and biogenesis; single fertilization; transmembrane receptor protein serine/threonine kinase signaling pathway; cell motility; signal transduction

Research Articles on AKAP4

Similar Products

Product Notes

The AKAP4 akap4 (Catalog #AAA6226454) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's AKAP4 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AKAP4 akap4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AKAP4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.