Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.55kD).)

Mouse anti-Human AKAP17A Monoclonal Antibody

AKAP17A (A-kinase Anchor Protein 17A, AKAP-17A, 721P, B-lymphocyte Antigen, CCDC133, CXYorf3, DXYS155E, Protein Kinase A-anchoring Protein 17A, PRKA17A, Protein XE7, RP13-297E16.1, Splicing Factor, Arginine/serine-rich 17A, SFRS17A, XE7, XE7Y)

Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
AKAP17A; Monoclonal Antibody; AKAP17A (A-kinase Anchor Protein 17A; AKAP-17A; 721P; B-lymphocyte Antigen; CCDC133; CXYorf3; DXYS155E; Protein Kinase A-anchoring Protein 17A; PRKA17A; Protein XE7; RP13-297E16.1; Splicing Factor; Arginine/serine-rich 17A; SFRS17A; XE7; XE7Y); Anti -AKAP17A (A-kinase Anchor Protein 17A; anti-AKAP17A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2G8
Specificity
Recognizes human RP13-297E16.1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
ERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKSLVKSFLACLDGKTIKLSGFSDILKVRAAEFKIDFPTRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPC*
Applicable Applications for anti-AKAP17A antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
Suitable for use in ELISA, Immunohistochemistry, Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml
Immunogen
Partial recombinant corresponding to aa53-157 from RP13-297E16.1 (NP_005079) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.55kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.55kD).)

Western Blot (WB)

(RP13-297E16 1 monoclonal antibody Western Blot analysis of RP13-297E16 1 expression in Hela NE.)

Western Blot (WB) (RP13-297E16 1 monoclonal antibody Western Blot analysis of RP13-297E16 1 expression in Hela NE.)

Western Blot (WB)

(Western Blot analysis of SFRS17A expression in transfected 293T cell line by RP13-297E16.1 monoclonal antibody |Lane 1: SFRS17A transfected lysate (51.5kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SFRS17A expression in transfected 293T cell line by RP13-297E16.1 monoclonal antibody |Lane 1: SFRS17A transfected lysate (51.5kD).|Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RP13-297E16.1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to RP13-297E16.1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RP13-297E16.1 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RP13-297E16.1 on HeLa cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-AKAP17A antibody

Similar Products

Product Notes

The AKAP17A (Catalog #AAA6012508) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AKAP17A (A-kinase Anchor Protein 17A, AKAP-17A, 721P, B-lymphocyte Antigen, CCDC133, CXYorf3, DXYS155E, Protein Kinase A-anchoring Protein 17A, PRKA17A, Protein XE7, RP13-297E16.1, Splicing Factor, Arginine/serine-rich 17A, SFRS17A, XE7, XE7Y) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AKAP17A can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). Suitable for use in ELISA, Immunohistochemistry, Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml. Researchers should empirically determine the suitability of the AKAP17A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ERLKGMVQNH QFSTLRISKS TMDFIRFEGE VENKSLVKSF LACLDGKTIK LSGFSDILKV RAAEFKIDFP TRHDWDSFFR DAKDMNETLP GERPDTIHLE GLPC*. It is sometimes possible for the material contained within the vial of "AKAP17A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.